KEGG   Homo sapiens (human): 1028Help
Entry
1028              CDS       T01001                                 

Gene name
CDKN1C, BWCR, BWS, KIP2, WBS, p57, p57Kip2
Definition
(RefSeq) cyclin dependent kinase inhibitor 1C
  KO
K09993  cyclin-dependent kinase inhibitor 1C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H00033  Adrenal carcinoma
H00713  Beckwith-Wiedemann syndrome
H02319  IMAGE syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1028 (CDKN1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 1028
NCBI-ProteinID: NP_000067
OMIM: 600856
HGNC: 1786
Ensembl: ENSG00000129757
Vega: OTTHUMG00000010040
Pharos: P49918(Tbio)
UniProt: P49918
LinkDB All DBs
Position
11p15.4
AA seq 316 aa AA seqDB search
MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNR
WDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLE
PAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAP
APAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLAD
QLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA
APGVGSVEQTPRKRLR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcgtccctccgcagcacatccacgatggagcgtcttgtcgcccgtgggacc
ttcccagtactagtgcgcaccagcgcctgccgcagcctcttcgggccggtggaccacgag
gagctgagccgcgagctgcaggcccgcctggccgagctgaacgccgaggaccagaaccgc
tgggattacgacttccagcaggacatgccgctgcggggccctggacgcctgcagtggacc
gaagtggacagcgactcggtgcccgcgttctaccgcgagacggtgcaggtggggcgctgc
cgcctgctgctggcgccgcggcccgtcgcggtcgcggtggctgtcagcccgcccctcgag
ccggccgctgagtccctcgacggcctcgaggaggcgccggagcagctgcctagtgtcccg
gtcccggccccggcgtccaccccgcccccagtcccggtcctggctccagccccggccccg
gctccggctccggtcgcggctccggtcgcggctccggtcgcggtcgcggtcctggccccg
gccccggccccggctccggctccggctccggccccggctccagtcgcggccccggcccca
gccccggccccggccccggccccggcccccgccccggccccggccccggacgcggcgcct
caagagagcgccgagcagggcgcgaaccaggggcagcgcggccaggagcctctcgctgac
cagctgcactcggggatttcgggacgtcccgcggccggcaccgcggccgccagcgccaac
ggcgcggcgatcaagaagctgtccgggcctctgatctccgatttcttcgccaagcgcaag
agatcagcgcctgagaagtcgtcgggcgatgtccccgcgccgtgtccctctccaagcgcc
gcccctggcgtgggctcggtggagcagaccccgcgcaagaggctgcggtga

DBGET integrated database retrieval system