KEGG   Homo sapiens (human): 1032Help
Entry
1032              CDS       T01001                                 

Gene name
CDKN2D, INK4D, p19, p19-INK4D
Definition
(RefSeq) cyclin dependent kinase inhibitor 2D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    1032 (CDKN2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1032 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 1032
NCBI-ProteinID: NP_001791
OMIM: 600927
HGNC: 1790
Ensembl: ENSG00000129355
Vega: OTTHUMG00000180583
Pharos: P55273(Tbio)
UniProt: P55273 A0A024R796
LinkDB All DBs
Structure
PDB: 

Position
19p13.2
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggttcgcgccggcgaccggctgagtggggcggcggcccggggcgac
gtgcaggaggtgcgccgccttctgcaccgggagctggtgcatcccgacgccctcaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctggagctg
ctgaagcaaggtgccagccccaatgtccaggacacctccggtaccagtccagtccatgac
gcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggctgatgtc
aacgtgcctgatggcaccggggcacttccaatccatctggcagttcaagagggtcacact
gctgtggtcagctttctggcagctgaatctgatctccatcgcagggacgccaggggtctc
acacccttggagctggcactgcagagaggggctcaggacctcgtggacatcctgcagggc
cacatggtggccccgctgtga

DBGET integrated database retrieval system