KEGG   Homo sapiens (human): 1032
Entry
1032              CDS       T01001                                 

Gene name
CDKN2D, INK4D, p19, p19-INK4D
Definition
(RefSeq) cyclin dependent kinase inhibitor 2D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    1032 (CDKN2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1032 (CDKN2D)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 1032
NCBI-ProteinID: NP_001791
OMIM: 600927
HGNC: 1790
Ensembl: ENSG00000129355
Vega: OTTHUMG00000180583
Pharos: P55273(Tbio)
UniProt: P55273 A0A024R796
LinkDB
Structure
PDB: 
1BD8 1BI8

Position
19p13.2
AA seq 166 aa
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atgctgctggaggaggttcgcgccggcgaccggctgagtggggcggcggcccggggcgac
gtgcaggaggtgcgccgccttctgcaccgggagctggtgcatcccgacgccctcaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctggagctg
ctgaagcaaggtgccagccccaatgtccaggacacctccggtaccagtccagtccatgac
gcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggctgatgtc
aacgtgcctgatggcaccggggcacttccaatccatctggcagttcaagagggtcacact
gctgtggtcagctttctggcagctgaatctgatctccatcgcagggacgccaggggtctc
acacccttggagctggcactgcagagaggggctcaggacctcgtggacatcctgcagggc
cacatggtggccccgctgtga

DBGET integrated database retrieval system