KEGG   Homo sapiens (human): 10326Help
Entry
10326             CDS       T01001                                 

Gene name
SIRPB1, CD172b, SIRP-BETA-1
Definition
(RefSeq) signal regulatory protein beta 1
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    10326 (SIRPB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    10326 (SIRPB1)
   04090 CD molecules [BR:hsa04090]
    10326 (SIRPB1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  SIRP family
   10326 (SIRPB1)
CD molecules [BR:hsa04090]
 Proteins
  10326 (SIRPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 C2-set_2 V-set ig Ig_2 I-set Eryth_link_C
Motif
Other DBs
NCBI-GeneID: 10326
NCBI-ProteinID: NP_001129316
OMIM: 603889
HGNC: 15928
Ensembl: ENSG00000101307
Vega: OTTHUMG00000031676
Pharos: Q5TFQ8(Tbio)
UniProt: Q5TFQ8
LinkDB All DBs
Structure
PDB: 

Position
20p13
AA seq 398 aa AA seqDB search
MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQVIQPDKSISVAAGESATLHCTVTSLI
PVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISNITPADAGTYYC
VKFRKGSPDHVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDIT
LKWFKNGNELSDFQTNVDPAGDSVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLR
GTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAST
LTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTA
PGPALASAAPLLIAFLLGPKVLLVVGVSVIYVYWKQKA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgccagcctcctggccccaccttcctagtcctttcctgctgatgacgctactg
ctggggagactcacaggggtagctggcgaggaagagctgcaggtgattcagcctgacaag
tccatatcagttgcagctggagagtcggccactctgcactgcactgtgacttccctgatc
cctgtggggcccatccagtggttcagaggagctggaccaggccgggaattaatctacaat
cagaaagaaggccacttcccacgggtaacaactgtttcagacctcacaaagagaaacaac
atggacttttccatccgcatcagtaacatcaccccagcagatgccggcacctactactgt
gtgaagttccggaaagggagccccgaccacgtggagtttaagtctggagcaggcaccgag
ctgtctgtgcgtgccaaaccctctgcccccgtggtatcgggccctgcggcgagggccaca
cctcagcacacagtgagcttcacctgcgagtcccacggcttctcacccagagacatcacc
ctgaaatggttcaaaaatgggaatgagctctcagacttccagaccaacgtggaccccgca
ggagacagtgtgtcctacagcatccacagcacagccaaggtggtgctgacccgcgaggac
gttcactctcaagtcatctgcgaggtggcccacgtcaccttgcagggggaccctcttcgt
gggactgccaacttgtctgagaccatccgagttccacccaccttggaggttactcaacag
cccgtgagggcagagaaccaggtgaatgtcacctgccaggtgaggaagttctacccccag
agactacagctgacctggttggagaatggaaacgtgtccaggacagaaacggcctcaacc
cttacagaaaacaaggatggtacctacaactggatgagctggctcctggtgaatgtatct
gcccacagggatgatgtgaagctcacctgccaggtggagcatgacgggcagccagcggtc
agcaaaagccatgacctgaaggtctcagcccacccgaaggagcagggctcaaatactgct
cctggcccagcactggcttctgctgctccacttctcatagctttcctcctgggccccaag
gtgctgctggtggttggtgtctctgtcatctatgtctactggaagcagaaggcctga

KEGG   Homo sapiens (human): 140885Help
Entry
140885            CDS       T01001                                 

Gene name
SIRPA, BIT, CD172A, MFR, MYD-1, P84, PTPNS1, SHPS1, SIRP
Definition
(RefSeq) signal regulatory protein alpha
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    140885 (SIRPA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    140885 (SIRPA)
   04090 CD molecules [BR:hsa04090]
    140885 (SIRPA)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  SIRP family
   140885 (SIRPA)
CD molecules [BR:hsa04090]
 Proteins
  140885 (SIRPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 C2-set_2 V-set ig Ig_2 I-set SIT DUF4448 G6B Eryth_link_C TMEM154 Shisa Mid2 TMEM132D_C Orf78 Syndecan DUF4577 DUF2892
Motif
Other DBs
NCBI-GeneID: 140885
NCBI-ProteinID: NP_001035111
OMIM: 602461
HGNC: 9662
Ensembl: ENSG00000198053
Vega: OTTHUMG00000031682
Pharos: P78324(Tbio)
UniProt: P78324
LinkDB All DBs
Structure
PDB: 

Position
20p13
AA seq 504 aa AA seqDB search
MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSL
IPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI
TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPL
RGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS
TVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNT
AAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREI
TQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNR
TPKQPAPKPEPSFSEYASVQVPRK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgccggcccggcccccggccgcctcgggccgctgctctgcctgctgctcgcc
gcgtcctgcgcctggtcaggagtggcgggtgaggaggagctgcaggtgattcagcctgac
aagtccgtgttggttgcagctggagagacagccactctgcgctgcactgcgacctctctg
atccctgtggggcccatccagtggttcagaggagctggaccaggccgggaattaatctac
aatcaaaaagaaggccacttcccccgggtaacaactgtttcagacctcacaaagagaaac
aacatggacttttccatccgcatcggtaacatcaccccagcagatgccggcacctactac
tgtgtgaagttccggaaagggagccccgatgacgtggagtttaagtctggagcaggcact
gagctgtctgtgcgcgccaaaccctctgcccccgtggtatcgggccctgcggcgagggcc
acacctcagcacacagtgagcttcacctgcgagtcccacggcttctcacccagagacatc
accctgaaatggttcaaaaatgggaatgagctctcagacttccagaccaacgtggacccc
gtaggagagagcgtgtcctacagcatccacagcacagccaaggtggtgctgacccgcgag
gacgttcactctcaagtcatctgcgaggtggcccacgtcaccttgcagggggaccctctt
cgtgggactgccaacttgtctgagaccatccgagttccacccaccttggaggttactcaa
cagcccgtgagggcagagaaccaggtgaatgtcacctgccaggtgaggaagttctacccc
cagagactacagctgacctggttggagaatggaaacgtgtcccggacagaaacggcctca
accgttacagagaacaaggatggtacctacaactggatgagctggctcctggtgaatgta
tctgcccacagggatgatgtgaagctcacctgccaggtggagcatgacgggcagccagcg
gtcagcaaaagccatgacctgaaggtctcagcccacccgaaggagcagggctcaaatacc
gccgctgagaacactggatctaatgaacggaacatctatattgtggtgggtgtggtgtgc
accttgctggtggccctactgatggcggccctctacctcgtccgaatcagacagaagaaa
gcccagggctccacttcttctacaaggttgcatgagcccgagaagaatgccagagaaata
acacaggacacaaatgatatcacatatgcagacctgaacctgcccaaggggaagaagcct
gctccccaggctgcggagcccaacaaccacacggagtatgccagcattcagaccagcccg
cagcccgcgtcggaggacaccctcacctatgctgacctggacatggtccacctcaaccgg
acccccaagcagccggcccccaagcctgagccgtccttctcagagtacgccagcgtccag
gtcccgaggaagtga

KEGG   Homo sapiens (human): 54209Help
Entry
54209             CDS       T01001                                 

Gene name
TREM2, PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c
Definition
(RefSeq) triggering receptor expressed on myeloid cells 2
  KO
K14378  triggering receptor expressed on myeloid cells 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Disease
H00438  Nasu-Hakola disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    54209 (TREM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 54209
NCBI-ProteinID: NP_061838
OMIM: 605086
HGNC: 17761
Ensembl: ENSG00000095970
Vega: OTTHUMG00000014671
Pharos: Q9NZC2(Tbio)
UniProt: Q9NZC2 Q5TCX1
LinkDB All DBs
Structure
PDB: 

Position
6p21.1
AA seq 230 aa AA seqDB search
MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPC
QRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADT
LRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLA
CIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagcctctccggctgctcatcttactctttgtcacagagctgtccggagcccacaac
accacagtgttccagggcgtggcgggccagtccctgcaggtgtcttgcccctatgactcc
atgaagcactgggggaggcgcaaggcctggtgccgccagctgggagagaagggcccatgc
cagcgtgtggtcagcacgcacaacttgtggctgctgtccttcctgaggaggtggaatggg
agcacagccatcacagacgataccctgggtggcactctcaccattacgctgcggaatcta
caaccccatgatgcgggtctctaccagtgccagagcctccatggcagtgaggctgacacc
ctcaggaaggtcctggtggaggtgctggcagaccccctggatcaccgggatgctggagat
ctctggttccccggggagtctgagagcttcgaggatgcccatgtggagcacagcatctcc
aggagcctcttggaaggagaaatccccttcccacccacttccatccttctcctcctggcc
tgcatctttctcatcaagattctagcagccagcgccctctgggctgcagcctggcatgga
cagaagccagggacacatccacccagtgaactggactgtggccatgacccagggtatcag
ctccaaactctgccagggctgagagacacgtga

KEGG   Homo sapiens (human): 55423Help
Entry
55423             CDS       T01001                                 

Gene name
SIRPG, CD172g, SIRP-B2, SIRPB2, SIRPgamma, bA77C3.1
Definition
(RefSeq) signal regulatory protein gamma
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    55423 (SIRPG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    55423 (SIRPG)
   04090 CD molecules [BR:hsa04090]
    55423 (SIRPG)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  SIRP family
   55423 (SIRPG)
CD molecules [BR:hsa04090]
 Proteins
  55423 (SIRPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 C2-set_2 V-set Ig_2 ig I-set
Motif
Other DBs
NCBI-GeneID: 55423
NCBI-ProteinID: NP_061026
OMIM: 605466
HGNC: 15757
Ensembl: ENSG00000089012
Vega: OTTHUMG00000031680
Pharos: Q9P1W8(Tbio)
UniProt: Q9P1W8
LinkDB All DBs
Structure
PDB: 

Position
20p13
AA seq 387 aa AA seqDB search
MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLP
VGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCV
KFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITL
KWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRG
TANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQRETASTL
TENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATP
GPASSLTALLLIAVLLGPIYVPWKQKT
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcccagcctcctggccccatcctcctggtcctttcctgcttctgactctactg
ctgggacttacagaagtggcaggtgaggaggagctacagatgattcagcctgagaagctc
ctgttggtcacagttggaaagacagccactctgcactgcactgtgacctccctgcttccc
gtgggacccgtcctgtggttcagaggagttggaccaggccgggaattaatctacaatcaa
aaagaaggccacttccccagggtaacaacagtttcagacctcacaaagagaaacaacatg
gacttttccatccgcatcagtagcatcaccccagcagatgtcggcacatactactgtgtg
aagtttcgaaaagggagccctgagaacgtggagtttaagtctggaccaggcactgagatg
gctttgggtgccaaaccctctgcccccgtggtattgggccctgcggcgaggaccacacct
gagcatacagtgagtttcacctgtgagtcccatggcttctctcccagagacatcaccctg
aaatggttcaaaaatgggaatgagctctcagacttccagaccaacgtggaccccacagga
cagagtgtggcctacagcatccgcagcacagccagggtggtactggacccctgggacgtt
cgctctcaggtcatctgcgaggtggcccatgtcaccttgcagggggaccctcttcgtggg
actgccaacttgtctgaggccatccgagttccacccaccttggaggttactcaacagccc
atgagggtggggaaccaggtaaacgtcacctgccaggtgaggaagttctacccccagagc
ctacagctgacctggtcggagaatggaaacgtgtgccagagagaaacagcctcgaccctt
acagagaacaaggatggtacctacaactggacaagctggttcctggtgaacatatctgac
caaagggatgatgtggtcctcacctgccaggtgaagcatgatgggcagctggcggtcagc
aaacgccttgccctagaggtcacagtccaccagaaggaccagagctcagatgctacccct
ggcccggcatcatcccttactgcgctgctcctcatagctgtcctcctgggccccatctac
gtcccctggaagcagaagacctga

DBGET integrated database retrieval system