KEGG   Homo sapiens (human): 10342Help
Entry
10342             CDS       T01001                                 

Gene name
TFG, HMSNP, SPG57, TF6, TRKT3
Definition
(RefSeq) trafficking from ER to golgi regulator
  KO
K09292  protein TFG
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
Disease
H00032  Thyroid cancer
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10342 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    10342 (TFG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PB1
Motif
Other DBs
NCBI-GeneID: 10342
NCBI-ProteinID: NP_001007566
OMIM: 602498
HGNC: 11758
Ensembl: ENSG00000114354
Vega: OTTHUMG00000159085
Pharos: Q92734(Tbio)
UniProt: Q92734
LinkDB All DBs
Position
3q12.2
AA seq 400 aa AA seqDB search
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKN
VMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIE
GQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPR
PGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacagttggatctaagtgggaagctaatcatcaaagctcaacttggggaggat
attcggcgaattcctattcataatgaagatattacttatgatgaattagtgctaatgatg
caacgagttttcagaggaaaacttctgagtaatgatgaagtaacaataaagtataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcctttgcaattcagtgc
agtaggatactgaaactgacattatttgttaatggccagccaagaccccttgaatcaagt
caggtgaaatatctccgtcgagaactgatagaacttcgaaataaagtgaatcgtttattg
gatagcttggaaccacctggagaaccaggaccttccaccaatattcctgaaaatgatact
gtggatggtagggaagaaaagtctgcttctgattcttctggaaaacagtctactcaggtt
atggcagcaagtatgtctgcttttgatcctttaaaaaaccaagatgaaatcaataaaaat
gttatgtcagcgtttggcttaacagatgatcaggtttcagggccacccagtgctcctgca
gaagatcgttcaggaacacccgacagcattgcttcctcctcctcagcagctcacccacca
ggcgttcagccacagcagccaccatatacaggagctcagactcaagcaggtcagattgaa
ggtcagatgtaccaacagtaccagcaacaggccggctatggtgcacagcagccgcaggct
ccacctcagcagcctcaacagtatggtattcagtattcagcaagctatagtcagcagact
ggacctcaacaacctcagcagttccagggatatggccagcaaccaacttcccaggcacca
gctcctgccttttctggtcagcctcaacaactgcctgctcagccgccacagcagtaccag
gcgagcaattatcctgcacaaacttacactgcccaaacttctcagcctactaattatact
gtggctcctgcctctcaacctggaatggctccaagccaacctggggcctatcaaccaaga
ccaggttttacttcacttcctggaagtaccatgacccctcctccaagtgggcctaatcct
tatgcgcgtaaccgtcctccctttggtcagggctatacccaacctggacctggttatcga
taa

KEGG   Homo sapiens (human): 4914Help
Entry
4914              CDS       T01001                                 

Gene name
NTRK1, MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
hsa05230  Central carbon metabolism in cancer
Network
nt06210  ERK signaling
nt06240  Transcription
nt06274  Thyroid cancer
  Element
N00009  TRK fusion kinase to RAS-ERK signaling pathway
N00132  Amplified MYCN to transcriptional repression
Disease
H00032  Thyroid cancer
H00043  Neuroblastoma
H00265  Hereditary sensory and autonomic neuropathy
H01836  Congenital pain insensitivity with anhidrosis
Drug target
Entrectinib: D10926
Larotrectinib (DG02923): D11137 D11138
Pegcantratinib: D11484
Repotrectinib: D11454
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4914 (NTRK1)
   04010 MAPK signaling pathway
    4914 (NTRK1)
   04151 PI3K-Akt signaling pathway
    4914 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    4914 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4914 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    4914 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4914 (NTRK1)
   05202 Transcriptional misregulation in cancer
    4914 (NTRK1)
   05230 Central carbon metabolism in cancer
    4914 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    4914 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4914 (NTRK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4914 (NTRK1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   4914 (NTRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TPKR_C2 I-set LRR_8 TrkA_TMD Ig_3 Ig_2 LRR_4
Motif
Other DBs
NCBI-GeneID: 4914
NCBI-ProteinID: NP_002520
OMIM: 191315
HGNC: 8031
Ensembl: ENSG00000198400
Vega: OTTHUMG00000041304
Pharos: P04629(Tchem)
UniProt: P04629
LinkDB All DBs
Structure
PDB: 

Position
1q23.1
AA seq 796 aa AA seqDB search
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaggcggacggcgcgggcagcttggctggcacagctgggctgcggggccgggc
agcctgctggcttggctgatactggcatctgcgggcgccgcaccctgccccgatgcctgc
tgcccccacggctcctcgggactgcgatgcacccgggatggggccctggatagcctccac
cacctgcccggcgcagagaacctgactgagctctacatcgagaaccagcagcatctgcag
catctggagctccgtgatctgaggggcctgggggagctgagaaacctcaccatcgtgaag
agtggtctccgtttcgtggcgccagatgccttccatttcactcctcggctcagtcgcctg
aatctctccttcaacgctctggagtctctctcctggaaaactgtgcagggcctctcctta
caggaactggtcctgtcggggaaccctctgcactgttcttgtgccctgcgctggctacag
cgctgggaggaggagggactgggcggagtgcctgaacagaagctgcagtgtcatgggcaa
gggcccctggcccacatgcccaatgccagctgtggtgtgcccacgctgaaggtccaggtg
cccaatgcctcggtggatgtgggggacgacgtgctgctgcggtgccaggtggaggggcgg
ggcctggagcaggccggctggatcctcacagagctggagcagtcagccacggtgatgaaa
tctgggggtctgccatccctggggctgaccctggccaatgtcaccagtgacctcaacagg
aagaacgtgacgtgctgggcagagaacgatgtgggccgggcagaggtctctgttcaggtc
aacgtctccttcccggccagtgtgcagctgcacacggcggtggagatgcaccactggtgc
atccccttctctgtggatgggcagccggcaccgtctctgcgctggctcttcaatggctcc
gtgctcaatgagaccagcttcatcttcactgagttcctggagccggcagccaatgagacc
gtgcggcacgggtgtctgcgcctcaaccagcccacccacgtcaacaacggcaactacacg
ctgctggctgccaaccccttcggccaggcctccgcctccatcatggctgccttcatggac
aaccctttcgagttcaaccccgaggaccccatccctgtctccttctcgccggtggacact
aacagcacatctggagacccggtggagaagaaggacgaaacaccttttggggtctcggtg
gctgtgggcctggccgtctttgcctgcctcttcctttctacgctgctccttgtgctcaac
aaatgtggacggagaaacaagtttgggatcaaccgcccggctgtgctggctccagaggat
gggctggccatgtccctgcatttcatgacattgggtggcagctccctgtcccccaccgag
ggcaaaggctctgggctccaaggccacatcatcgagaacccacaatacttcagtgatgcc
tgtgttcaccacatcaagcgccgggacatcgtgctcaagtgggagctgggggagggcgcc
tttgggaaggtcttccttgctgagtgccacaacctcctgcctgagcaggacaagatgctg
gtggctgtcaaggcactgaaggaggcgtccgagagtgctcggcaggacttccagcgtgag
gctgagctgctcaccatgctgcagcaccagcacatcgtgcgcttcttcggcgtctgcacc
gagggccgccccctgctcatggtctttgagtatatgcggcacggggacctcaaccgcttc
ctccgatcccatggacctgatgccaagctgctggctggtggggaggatgtggctccaggc
cccctgggtctggggcagctgctggccgtggctagccaggtcgctgcggggatggtgtac
ctggcgggtctgcattttgtgcaccgggacctggccacacgcaactgtctagtgggccag
ggactggtggtcaagattggtgattttggcatgagcagggatatctacagcaccgactat
taccgtgtgggaggccgcaccatgctgcccattcgctggatgccgcccgagagcatcctg
taccgtaagttcaccaccgagagcgacgtgtggagcttcggcgtggtgctctgggagatc
ttcacctacggcaagcagccctggtaccagctctccaacacggaggcaatcgactgcatc
acgcagggacgtgagttggagcggccacgtgcctgcccaccagaggtctacgccatcatg
cggggctgctggcagcgggagccccagcaacgccacagcatcaaggatgtgcacgcccgg
ctgcaagccctggcccaggcacctcctgtctacctggatgtcctgggctag

KEGG   Homo sapiens (human): 7170Help
Entry
7170              CDS       T01001                                 

Gene name
TPM3, CAPM1, CFTD, HEL-189, HEL-S-82p, NEM1, OK/SW-cl.5, TM-5, TM3, TM30, TM30nm, TM5, TPM3nu, TPMsk3, TRK, hscp30
Definition
(RefSeq) tropomyosin 3
  KO
K09290  tropomyosin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00032  Thyroid cancer
H00698  Nemaline myopathy
H00701  Congenital fiber type disproportion
H00702  Cap myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7170 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    7170 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7170 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    7170 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    7170 (TPM3)
   05414 Dilated cardiomyopathy (DCM)
    7170 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7170 (TPM3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     7170 (TPM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ ERM TMF_DNA_bd XhlA DUF745 CENP-F_leu_zip ATG16 HrpB7 DHR10 SlyX DUF1664 AAA_13 Lebercilin Laminin_I DUF16 MAD
Motif
Other DBs
NCBI-GeneID: 7170
NCBI-ProteinID: NP_689476
OMIM: 191030
HGNC: 12012
Ensembl: ENSG00000143549
Vega: OTTHUMG00000035853
Pharos: P06753(Tbio)
UniProt: P06753
LinkDB All DBs
Position
1q21.3
AA seq 285 aa AA seqDB search
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctgaagttagacaaggagaatgctctg
gatcgggcagagcaagctgaagctgagcagaagcaggcagaagaaagaagtaaacagctg
gaggatgagctggcagccatgcagaagaagctgaaagggacagaggatgagctggacaag
tattctgaagctttgaaggatgcccaggagaagctggaactggcagagaagaaggctgct
gatgctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaagaagagctg
gaccgtgctcaggagcgcctggccactgccctgcaaaagctggaagaagctgaaaaagct
gctgatgagagtgagagaggtatgaaggttattgaaaaccgggccttaaaagatgaagaa
aagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaagaggcagat
aggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagacttggaacgcaca
gaggaacgagctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaat
gtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaaaaagaagat
aaatatgaggaagaaatcaagattcttactgataaactcaaggaggcagagacccgtgct
gagtttgctgagagatcggtagccaagctggaaaagacaattgatgacctggaagatgag
ctctatgcccagaaactgaagtacaaggccattagcgaggagctggaccacgccctcaat
gacatgacctctatataa

KEGG   Homo sapiens (human): 7175Help
Entry
7175              CDS       T01001                                 

Gene name
TPR
Definition
(RefSeq) translocated promoter region, nuclear basket protein
  KO
K09291  nucleoprotein TPR
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
Disease
H00032  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    7175 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7175 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    7175 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7175 (TPR)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     7175 (TPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_MLP1_2 Seryl_tRNA_N DUF5082 DUF1192
Motif
Other DBs
NCBI-GeneID: 7175
NCBI-ProteinID: NP_003283
OMIM: 189940
HGNC: 12017
Ensembl: ENSG00000047410
Vega: OTTHUMG00000035580
Pharos: P12270(Tbio)
UniProt: P12270
LinkDB All DBs
Structure
PDB: 

Position
1q31.1
AA seq 2363 aa AA seqDB search
MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKR
LSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEEL
EAEKRDLIRTNERLSQELEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYRE
KRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVSRLEEQM
NGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS
NELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLEKELENANDLL
SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSS
VLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY
RNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQ
MQLVDSIVRQRDMYRILLSQTTGVAIPLHASSLDDVSLASTPKRPSTSQTVSTPAPVPVI
ESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQVTDLRSQNTKISTQLDF
ASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVR
AENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ
IEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKE
IATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTS
NVEQYQAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQD
DKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQN
KYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLLECKASWEERERMLKD
EVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEIL
RFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE
ELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGM
LQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKA
EIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRR
YKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENL
QKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAA
KSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKSQYEGRISRLERELREH
QERHLEQRDEPQEPSNKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSK
VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPV
FGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSSNIVEV
VQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLK
SVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDL
GPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHEDYEEDEEDDDDDEDDTG
MGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGEGNHRAADSQNSGEG
NTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR
IQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAG
VPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAA
PVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAG
LEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRRVRLQTTLRQGVRGRQ
FNRQRGVSHAMGGRGGINRGNIN
NT seq 7092 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgttgcagcaagtcctggagcgcacggagctgaacaagctgcccaagtct
gtccagaacaaacttgaaaagttccttgctgatcagcaatccgagatcgatggcctgaag
gggcggcatgagaaatttaaggtggagagcgaacaacagtattttgaaatagaaaagagg
ttgtcccacagtcaggagagacttgtgaatgaaacccgagagtgtcaaagcttgcggctt
gagctagagaaactcaacaatcaactgaaggcactaactgagaaaaacaaagaacttgaa
attgctcaggatcgcaatattgccattcagagccaatttacaagaacaaaggaagaatta
gaagctgagaaaagagacttaattagaaccaatgagagactatctcaagaacttgaatac
ttaacagaggatgttaaacgtctgaatgaaaaacttaaagaaagcaatacaacaaagggt
gaacttcagttaaaattggatgaacttcaagcttctgatgtttctgttaagtatcgagaa
aaacgcttggagcaagaaaaggaattgctacatagtcagaatacatggctgaatacagag
ttgaaaaccaaaactgatgaacttctggctcttggaagagaaaaagggaatgagattcta
gagcttaaatgtaatcttgaaaataaaaaagaagaggtttctagactggaagaacaaatg
aatggcttaaaaacatcaaatgaacatcttcaaaagcatgtggaggatctgttgaccaaa
ttaaaagaggccaaggaacaacaggccagtatggaagagaaattccacaatgaattaaat
gcccacataaaactttctaatttgtacaagagtgccgctgatgactcagaagcaaagagc
aatgaactaacccgggcagtagaggaactacacaaacttttgaaagaagctggtgaagcc
aacaaagcaatacaagatcatcttctagaggtggagcaatccaaagatcaaatggaaaaa
gaaatgcttgagaaaatagggagattggagaaggaattagagaatgcaaatgaccttctt
tctgccacaaaacgtaaaggagccatattgtctgaagaagagcttgccgccatgtctcct
actgcagcagctgtagctaagatagtgaaacctgggatgaaactaactgagctctataat
gcttatgtggaaactcaggatcagttgcttttggagaaactagagaacaaaagaattaat
aagtacctagatgaaatagtgaaagaagtggaagccaaagcaccaattttgaaacgccag
cgtgaggaatatgaacgtgcacagaaagctgtagcaagtttatctgttaagcttgaacaa
gctatgaaggagattcagcgattgcaggaggacactgataaagccaacaagcaatcatct
gtacttgagagagataatcgaagaatggaaatacaagtaaaagatctttcacaacagatt
agagtgcttttgatggaacttgaagaagcaaggggtaaccacgtaattcgtgatgaggaa
gtaagctctgctgatataagtagttcatctgaggtaatatcacagcatctagtatcttac
agaaatattgaagagcttcaacaacaaaatcaacgtctcttagtggcccttagagagctt
ggggaaaccagagaaagagaagaacaagaaacaacttcatccaaaatcactgagcttcag
ctcaaacttgagagtgcccttactgaactagaacaactccgcaaatcacgacagcatcaa
atgcagcttgttgattccatagttcgtcagcgtgatatgtaccgtattttattgtcacaa
acaacaggagttgccattccattacatgcttcaagcttagatgatgtttctcttgcatca
actccaaaacgtccaagtacatcacagactgtttccactcctgctccagtacctgttatt
gaatcaacagaggctatagaggctaaggctgcccttaaacagttgcaggaaatttttgag
aactacaaaaaagaaaaagcagaaaatgaaaaaatacaaaatgagcagcttgagaaactt
caagaacaagttacagatttgcgatcacaaaataccaaaatttctacccagctagatttt
gcttctaaacgttatgaaatgctgcaagataatgttgaaggatatcgtcgagaaataaca
tcacttcatgagagaaatcagaaactcactgccacaactcaaaagcaagaacagattatc
aatacgatgactcaagatttgagaggagcaaatgagaagctagctgtcgcagaagtaaga
gcagaaaatttgaagaaggaaaaggaaatgcttaaattgtctgaagttcgtctttctcag
caaagagagtctttgttagctgaacaaagggggcaaaacttactgctaactaatctgcaa
acaattcagggaatactggagcgatctgaaacagaaaccaaacaaaggcttagtagccag
atagaaaaactggaacatgagatctctcatctaaagaagaagttggaaaatgaggtggaa
caaaggcatacacttactagaaatctagatgttcaacttttagatacaaagagacaactg
gatacagagacaaatcttcatcttaacacaaaagaactattaaaaaatgctcaaaaagaa
attgccacattgaaacagcacctcagtaatatggaagtccaagttgcttctcagtcttca
cagagaactggtaaaggtcagcctagcaacaaagaagatgtggatgatcttgtgagtcag
ctaagacagacagaagagcaggtgaatgacttaaaggagagactcaaaacaagtacgagc
aatgtggaacaatatcaagcaatggttactagtttagaagaatccctgaacaaggaaaaa
caggtgacagaagaagtgcgtaagaatattgaagttcgtttaaaagagtcagctgaattt
cagacacagttggaaaagaagttgatggaagtagagaaggaaaaacaagaacttcaggat
gataaaagaagagccatagagagcatggaacaacagttatctgaattgaagaaaacactt
tctagtgttcagaatgaagtacaagaagctcttcagagagcaagcacagctttaagtaat
gagcagcaagccagacgtgactgtcaggaacaagctaaaatagctgtggaagctcagaat
aagtatgagagagaattgatgctgcatgctgctgatgttgaagctctacaagctgcgaag
gagcaggtttcaaaaatggcatcagtccgtcagcatttggaagaaacaacacagaaagca
gaatcacagttgttggagtgtaaagcatcttgggaggaaagagagagaatgttaaaggat
gaagtttccaaatgtgtatgtcgctgtgaagatctggagaaacaaaacagattacttcat
gatcagatcgaaaaattaagtgacaaggtcgttgcctctgtgaaggaaggtgtacaaggt
ccactgaatgtatctctcagtgaagaaggaaaatctcaagaacaaattttggaaattctc
agatttatacgacgagaaaaagaaattgctgaaactaggtttgaggtggctcaggttgag
agtctgcgttatcgacaaagggttgaacttttagaaagagagctgcaggaactgcaagat
agtctaaatgctgaaagggagaaagtccaggtaactgcaaaaacaatggctcagcatgaa
gaactgatgaagaaaactgaaacaatgaatgtagttatggagaccaataaaatgctaaga
gaagagaaggagagactagaacaggatctacagcaaatgcaagcaaaggtgaggaaactg
gagttagatattttacccttacaagaagcaaatgctgagctgagtgagaaaagcggtatg
ttgcaggcagagaagaagctcttagaagaggatgtcaaacgttggaaagcacgtaaccag
catctagtaagtcaacagaaagatccagatacagaagaatatcggaagctcctttctgaa
aaggaagttcatactaagcgtattcaacaattgacagaagaaattggtagacttaaagct
gaaattgcaagatcaaatgcatctttgactaacaaccagaacttaattcagagtctgaag
gaagatctaaataaagtaagaactgaaaaggaaaccatccagaaggacttagatgccaaa
ataattgatatccaagaaaaagtcaaaactattactcaagttaagaaaattggacgtagg
tacaagactcaatatgaagaacttaaagcacaacaggataaggttatggagacatcggct
cagtcctctggagaccatcaggagcagcatgtttcagtccaggaaatgcaggaactcaaa
gaaacgctcaaccaagctgaaacaaaatcaaaatcacttgaaagtcaagtagagaatctg
cagaagacattatctgaaaaagagacagaagcaagaaatctccaggaacagactgtgcaa
cttcagtctgaactttcacgacttcgtcaggatcttcaagatagaaccacacaggaggag
cagctccgacaacagataactgaaaaggaagaaaaaaccagaaaggctattgtagcagca
aagtcaaaaattgcacacttagctggtgtaaaagatcagctaactaaagaaaatgaggag
cttaaacaaaggaatggagccttagatcagcagaaagatgaattggatgttcgcattact
gcgctaaagtcccaatatgaaggtcgaattagtcgcttggaaagagaactcagggagcat
caagagagacaccttgagcagagagatgagcctcaagaaccttctaataaggtccctgaa
cagcagagacagatcacattgaaaacaactccagcttctggtgaaagaggaattgccagc
acatcagacccaccaacagccaatatcaagccaactcctgttgtgtctactccaagtaaa
gtgacagctgcagctatggctggaaataagtcaacacccagggctagtatccgcccaatg
gttacacctgcaactgttacaaatcccactactaccccaacagctacagtgatgcccact
acacaagtggaatcacaggaagctatgcagtcagaagggcctgtggaacatgttccagtt
tttggaagcacaagtggatccgttcgttctactagtcctaatgtccagccttctatctct
caacctattttaactgttcagcaacaaacacaggctacagcttttgtgcaacccactcaa
cagagtcatcctcagattgagcctgccaatcaagagttatcttcaaacatagtagaggtt
gttcagagttcaccagttgagcggccttctacttccacagcagtatttggcacagtttcg
gctacccccagttcttctttgccaaagcgtacacgtgaagaggaagaggatagcaccata
gaagcatcagaccaagtctctgatgatacagtggaaatgcctcttccaaagaagttgaaa
agtgtcacacctgtaggaactgaggaagaagttatggcagaagaaagtactgatggagag
gtagagactcaggtatacaaccaggattctcaagattccattggagaaggagttacccag
ggagattatacacctatggaagacagtgaagaaacctctcagtctctacaaatagatctt
gggccacttcaatcagatcagcagacgacaacttcatcccaggatggtcaaggcaaagga
gatgatgtcattgtaattgacagtgatgatgaagaagaggatgatgatgaaaatgatgga
gaacatgaggattatgaagaggatgaggaagatgatgatgatgatgaagatgacacaggg
atgggagatgagggtgaagatagtaatgaaggaactggtagtgccgatggcaatgatggt
tatgaagctgatgatgctgagggtggtgatgggactgatccaggtacagaaacagaagaa
agtatgggtggaggtgaaggtaatcacagagctgctgattctcaaaacagtggtgaagga
aatacaggtgctgcagaatcttctttttctcaggaggtttctagagaacaacagccatca
tcagcatctgaaagacaggcccctcgagcacctcagtcaccgagacgcccaccacatcca
cttcccccaagactgaccattcatgccccacctcaggagttgggaccaccagttcagaga
attcagatgacccgaaggcagtctgtaggacgtggccttcagttgactccaggaataggt
ggcatgcaacagcatttttttgatgatgaagacagaacagttccaagtactccaactctt
gtggtgccacatcgtactgatggatttgctgaagcaattcattcgccgcaggttgctggt
gtccctagattccggtttgggccacctgaagatatgccacaaacaagttctagtcactct
gatcttggccagcttgcttctcaaggaggtttaggaatgtatgaaacacccctgttccta
gctcatgaagaagagtcaggtggccgaagtgttcccactactccactacaagtagcagcc
ccagtgactgtatttactgagagcaccacctctgatgcttcggaacatgcctctcaatct
gttccaatggtgactacatccactggcactttatctacaacaaatgaaacagcaacaggt
gatgatggagatgaagtatttgtggaggcagaatctgaaggtattagttcagaagcaggc
ctagaaattgatagccagcaggaagaagagccggttcaagcatctgatgagtcagatctc
ccctccaccagccaggatcctccttctagctcatctgtagatactagtagtagtcaacca
aagcctttcagacgagtaagacttcagacaacattgagacaaggtgtccgtggtcgtcag
tttaacagacagagaggtgtgagccatgcaatgggagggagaggaggaataaacagagga
aatattaattaa

DBGET integrated database retrieval system