KEGG   Homo sapiens (human): 10344Help
Entry
10344             CDS       T01001                                 

Gene name
CCL26, IMAC, MIP-4a, MIP-4alpha, SCYA26, TSC-1
Definition
(RefSeq) C-C motif chemokine ligand 26
  KO
K21096  C-C motif chemokine 26
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Disease
H01360  Allergic rhinitis
H01361  Eosinophilic esophagitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10344 (CCL26)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10344 (CCL26)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10344 (CCL26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10344 (CCL26)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10344 (CCL26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 Gln_deamidase_2
Motif
Other DBs
NCBI-GeneID: 10344
NCBI-ProteinID: NP_006063
OMIM: 604697
HGNC: 10625
Ensembl: ENSG00000006606
Vega: OTTHUMG00000130403
Pharos: Q9Y258(Tbio)
UniProt: Q9Y258
LinkDB All DBs
Structure
PDB: 

Position
7q11.23
AA seq 94 aa AA seqDB search
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQR
AVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcctctccttggcctctgctgtgctcctggcctccctcctgagtctccacctt
ggaactgccacacgtgggagtgacatatccaagacctgctgcttccaatacagccacaag
ccccttccctggacctgggtgcgaagctatgaattcaccagtaacagctgctcccagcgg
gctgtgatattcactaccaaaagaggcaagaaagtctgtacccatccaaggaaaaaatgg
gtgcaaaaatacatttctttactgaaaactccgaaacaattgtga

KEGG   Homo sapiens (human): 10563Help
Entry
10563             CDS       T01001                                 

Gene name
CXCL13, ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13
Definition
(RefSeq) C-X-C motif chemokine ligand 13
  KO
K10032  C-X-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10563 (CXCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10563 (CXCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10563 (CXCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10563 (CXCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10563 (CXCL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 10563
NCBI-ProteinID: NP_006410
OMIM: 605149
HGNC: 10639
Ensembl: ENSG00000156234
Vega: OTTHUMG00000130201
Pharos: O43927(Tbio)
UniProt: O43927 Q53X90
LinkDB All DBs
Structure
PDB: 

Position
4q21.1
AA seq 109 aa AA seqDB search
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcatctcgacatctctgcttctcatgctgctggtcagcagcctctctccagtc
caaggtgttctggaggtctattacacaagcttgaggtgtagatgtgtccaagagagctca
gtctttatccctagacgcttcattgatcgaattcaaatcttgccccgtgggaatggttgt
ccaagaaaagaaatcatagtctggaagaagaacaagtcaattgtgtgtgtggaccctcaa
gctgaatggatacaaagaatgatggaagtattgagaaaaagaagttcttcaactctacca
gttccagtgtttaagagaaagattccctga

KEGG   Homo sapiens (human): 10850Help
Entry
10850             CDS       T01001                                 

Gene name
CCL27, ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
Definition
(RefSeq) C-C motif chemokine ligand 27
  KO
K16598  C-C motif chemokine 27
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10850 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10850 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10850 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10850 (CCL27)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10850 (CCL27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 10850
NCBI-ProteinID: NP_006655
OMIM: 604833
HGNC: 10626
Ensembl: ENSG00000213927
Vega: OTTHUMG00000019834
Pharos: Q9Y4X3(Tbio)
UniProt: Q9Y4X3 Q5VZ77
LinkDB All DBs
Structure
PDB: 

Position
9p13.3
AA seq 112 aa AA seqDB search
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggcccccaaccttctgcagcctcctgctgctgtcattgctcctgagcccagac
cctacagcagcattcctactgccacccagcactgcctgctgtactcagctctaccgaaag
ccactctcagacaagctactgaggaaggtcatccaggtggaactgcaggaggctgacggg
gactgtcacctccaggctttcgtgcttcacctggctcaacgcagcatctgcatccacccc
cagaaccccagcctgtcacagtggtttgagcaccaagagagaaagctccatgggactctg
cccaagctgaattttgggatgctaaggaaaatgggctga

KEGG   Homo sapiens (human): 2919Help
Entry
2919              CDS       T01001                                 

Gene name
CXCL1, FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1
Definition
(RefSeq) C-X-C motif chemokine ligand 1
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    2919 (CXCL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2919 (CXCL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2919 (CXCL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2919 (CXCL1)
   04657 IL-17 signaling pathway
    2919 (CXCL1)
   04062 Chemokine signaling pathway
    2919 (CXCL1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    2919 (CXCL1)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2919 (CXCL1)
   05132 Salmonella infection
    2919 (CXCL1)
   05134 Legionellosis
    2919 (CXCL1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2919 (CXCL1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2919 (CXCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2919 (CXCL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2919 (CXCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 2919
NCBI-ProteinID: NP_001502
OMIM: 155730
HGNC: 4602
Ensembl: ENSG00000163739
Vega: OTTHUMG00000160866
Pharos: P09341(Tbio)
UniProt: P09341
LinkDB All DBs
Structure
PDB: 

Position
4q13.3
AA seq 107 aa AA seqDB search
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgctgctctctccgccgcccccagcaatccccggctcctgcgagtggcactg
ctgctcctgctcctggtagccgctggccggcgcgcagcaggagcgtccgtggccactgaa
ctgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaacatccaaagtgtg
aacgtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggcggaaagcttgcctcaatcctgcatcccccatagttaagaaaatcatcgaaaagatg
ctgaacagtgacaaatccaactga

KEGG   Homo sapiens (human): 2920Help
Entry
2920              CDS       T01001                                 

Gene name
CXCL2, CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2
Definition
(RefSeq) C-X-C motif chemokine ligand 2
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    2920 (CXCL2)
   04668 TNF signaling pathway
    2920 (CXCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2920 (CXCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2920 (CXCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2920 (CXCL2)
   04657 IL-17 signaling pathway
    2920 (CXCL2)
   04062 Chemokine signaling pathway
    2920 (CXCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2920 (CXCL2)
   05132 Salmonella infection
    2920 (CXCL2)
   05134 Legionellosis
    2920 (CXCL2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2920 (CXCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2920 (CXCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2920 (CXCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 2920
NCBI-ProteinID: NP_002080
OMIM: 139110
HGNC: 4603
Ensembl: ENSG00000081041
Vega: OTTHUMG00000160865
Pharos: P19875(Tbio)
UniProt: P19875 A0A024RDD9
LinkDB All DBs
Structure
PDB: 

Position
4q13.3
AA seq 107 aa AA seqDB search
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgcccctggccactgaa
ctgcgctgccagtgcttgcagaccctgcagggaattcacctcaagaacatccaaagtgtg
aaggtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggcagaaagcttgtctcaaccccgcatcgcccatggttaagaaaatcatcgaaaagatg
ctgaaaaatggcaaatccaactga

KEGG   Homo sapiens (human): 2921Help
Entry
2921              CDS       T01001                                 

Gene name
CXCL3, CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
Definition
(RefSeq) C-X-C motif chemokine ligand 3
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    2921 (CXCL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2921 (CXCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2921 (CXCL3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2921 (CXCL3)
   04657 IL-17 signaling pathway
    2921 (CXCL3)
   04062 Chemokine signaling pathway
    2921 (CXCL3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2921 (CXCL3)
   05132 Salmonella infection
    2921 (CXCL3)
   05134 Legionellosis
    2921 (CXCL3)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2921 (CXCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2921 (CXCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2921 (CXCL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 Lenti_VIF_2
Motif
Other DBs
NCBI-GeneID: 2921
NCBI-ProteinID: NP_002081
OMIM: 139111
HGNC: 4604
Ensembl: ENSG00000163734
Vega: OTTHUMG00000160861
Pharos: P19876(Tbio)
UniProt: P19876
LinkDB All DBs
Position
4q13.3
AA seq 107 aa AA seqDB search
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgtccgtggtcactgaa
ctgcgctgccagtgcttgcagacactgcagggaattcacctcaagaacatccaaagtgtg
aatgtaaggtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggaagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcgaaaagata
ctgaacaaggggagcaccaactga

KEGG   Homo sapiens (human): 3576Help
Entry
3576              CDS       T01001                                 

Gene name
CXCL8, GCP-1, GCP1, IL8, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05219  Bladder cancer
hsa05323  Rheumatoid arthritis
Network
nt06124  Chemokine signaling (virus)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
nt06240  Transcription
  Element
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00544  HBV HBx to CREB-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    3576 (CXCL8)
   04072 Phospholipase D signaling pathway
    3576 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3576 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3576 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3576 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3576 (CXCL8)
   04621 NOD-like receptor signaling pathway
    3576 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    3576 (CXCL8)
   04657 IL-17 signaling pathway
    3576 (CXCL8)
   04062 Chemokine signaling pathway
    3576 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3576 (CXCL8)
   05202 Transcriptional misregulation in cancer
    3576 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    3576 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3576 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3576 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3576 (CXCL8)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3576 (CXCL8)
   05132 Salmonella infection
    3576 (CXCL8)
   05131 Shigellosis
    3576 (CXCL8)
   05135 Yersinia infection
    3576 (CXCL8)
   05133 Pertussis
    3576 (CXCL8)
   05134 Legionellosis
    3576 (CXCL8)
  09172 Infectious disease: viral
   05164 Influenza A
    3576 (CXCL8)
   05161 Hepatitis B
    3576 (CXCL8)
   05163 Human cytomegalovirus infection
    3576 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3576 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3576 (CXCL8)
   05144 Malaria
    3576 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    3576 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3576 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3576 (CXCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   3576 (CXCL8)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   3576 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 3576
NCBI-ProteinID: NP_000575
OMIM: 146930
HGNC: 6025
Ensembl: ENSG00000169429
Vega: OTTHUMG00000151316
Pharos: P10145(Tchem)
UniProt: P10145 A0A024RDA5
LinkDB All DBs
Structure
PDB: 

Position
4q13.3
AA seq 99 aa AA seqDB search
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacatac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaacacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa

KEGG   Homo sapiens (human): 3627Help
Entry
3627              CDS       T01001                                 

Gene name
CXCL10, C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1
Definition
(RefSeq) C-X-C motif chemokine ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05160  Hepatitis C
hsa05164  Influenza A
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (virus)
nt06165  Epstein-Barr virus (EBV)
  Element
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
Disease
H01360  Allergic rhinitis
Drug target
Eldelumab: D10404
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    3627 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3627 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3627 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3627 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    3627 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    3627 (CXCL10)
   04657 IL-17 signaling pathway
    3627 (CXCL10)
   04062 Chemokine signaling pathway
    3627 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    3627 (CXCL10)
   05160 Hepatitis C
    3627 (CXCL10)
   05169 Epstein-Barr virus infection
    3627 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3627 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3627 (CXCL10)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   3627 (CXCL10)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   3627 (CXCL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 3627
NCBI-ProteinID: NP_001556
OMIM: 147310
HGNC: 10637
Ensembl: ENSG00000169245
Vega: OTTHUMG00000160887
Pharos: P02778(Tbio)
UniProt: P02778 A0A024RDA4
LinkDB All DBs
Structure
PDB: 

Position
4q21.1
AA seq 98 aa AA seqDB search
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaactgccattctgatttgctgccttatctttctgactctaagtggcattcaa
ggagtacctctctctagaactgtacgctgtacctgcatcagcattagtaatcaacctgtt
aatccaaggtctttagaaaaacttgaaattattcctgcaagccaattttgtccacgtgtt
gagatcattgctacaatgaaaaagaagggtgagaagagatgtctgaatccagaatcgaag
gccatcaagaatttactgaaagcagttagcaaggaaaggtctaaaagatctccttaa

KEGG   Homo sapiens (human): 388372Help
Entry
388372            CDS       T01001                                 

Gene name
CCL4L1, AT744.2, CCL4L, LAG-1, LAG1, MIP-1-beta, SCYA4L, SCYA4L1, SCYA4L2
Definition
(RefSeq) C-C motif chemokine ligand 4 like 1
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05132  Salmonella infection
hsa05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    388372 (CCL4L1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    388372 (CCL4L1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    388372 (CCL4L1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    388372 (CCL4L1)
   04623 Cytosolic DNA-sensing pathway
    388372 (CCL4L1)
   04062 Chemokine signaling pathway
    388372 (CCL4L1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    388372 (CCL4L1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    388372 (CCL4L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    388372 (CCL4L1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   388372 (CCL4L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 388372
NCBI-ProteinID: NP_996890
OMIM: 603782
HGNC: 10631
UniProt: Q8NHW4 P13236 B7ZW36
LinkDB All DBs
Position
17q12
AA seq 92 aa AA seqDB search
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRGKQVCADPSESWVQEYVYDLELN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcgtgctagtagctgccttctgctctcta
gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaggcaagcaagtctgcgctgaccccagtgagtcc
tgggtccaggagtacgtgtatgacctggaactgaactga

KEGG   Homo sapiens (human): 414062Help
Entry
414062            CDS       T01001                                 

Gene name
CCL3L3, 464.2, D17S1718, G0S19-2, LD78, LD78BETA, SCYA3L, SCYA3L1
Definition
(RefSeq) C-C motif chemokine ligand 3 like 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    414062 (CCL3L3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    414062 (CCL3L3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    414062 (CCL3L3)
   04062 Chemokine signaling pathway
    414062 (CCL3L3)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    414062 (CCL3L3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    414062 (CCL3L3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    414062 (CCL3L3)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    414062 (CCL3L3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    414062 (CCL3L3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    414062 (CCL3L3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   414062 (CCL3L3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   414062 (CCL3L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 414062
NCBI-ProteinID: NP_001001437
OMIM: 609468
HGNC: 30554
Ensembl: ENSG00000276085
Vega: OTTHUMG00000188419
UniProt: P16619
LinkDB All DBs
Position
17q12
AA seq 93 aa AA seqDB search
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 4283Help
Entry
4283              CDS       T01001                                 

Gene name
CXCL9, CMK, Humig, MIG, SCYB9, crg-10
Definition
(RefSeq) C-X-C motif chemokine ligand 9
  KO
K05416  C-X-C motif chemokine 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4283 (CXCL9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    4283 (CXCL9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    4283 (CXCL9)
   04062 Chemokine signaling pathway
    4283 (CXCL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    4283 (CXCL9)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   4283 (CXCL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 VasL
Motif
Other DBs
NCBI-GeneID: 4283
NCBI-ProteinID: NP_002407
OMIM: 601704
HGNC: 7098
Ensembl: ENSG00000138755
Vega: OTTHUMG00000160889
Pharos: Q07325(Tbio)
UniProt: Q07325
LinkDB All DBs
Position
4q21.1
AA seq 125 aa AA seqDB search
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtggtgttcttttcctcttgggcatcatcttgctggttctgattggagtg
caaggaaccccagtagtgagaaagggtcgctgttcctgcatcagcaccaaccaagggact
atccacctacaatccttgaaagaccttaaacaatttgccccaagcccttcctgcgagaaa
attgaaatcattgctacactgaagaatggagttcaaacatgtctaaacccagattcagca
gatgtgaaggaactgattaaaaagtgggagaaacaggtcagccaaaagaaaaagcaaaag
aatgggaaaaaacatcaaaaaaagaaagttctgaaagttcgaaaatctcaacgttctcgt
caaaagaagactacataa

KEGG   Homo sapiens (human): 5196Help
Entry
5196              CDS       T01001                                 

Gene name
PF4, CXCL4, PF-4, SCYB4
Definition
(RefSeq) platelet factor 4
  KO
K05407  platelet factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5196 (PF4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    5196 (PF4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    5196 (PF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5196 (PF4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5196 (PF4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   5196 (PF4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   5196 (PF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 5196
NCBI-ProteinID: NP_002610
OMIM: 173460
HGNC: 8861
Ensembl: ENSG00000163737
Vega: OTTHUMG00000130009
Pharos: P02776(Tbio)
UniProt: P02776
LinkDB All DBs
Structure
PDB: 

Position
4q13.3
AA seq 101 aa AA seqDB search
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgcagccgggttctgcgcctcacgccccgggctgctgttcctggggttgctg
ctcctgccacttgtggtcgccttcgccagcgctgaagctgaagaagatggggacctgcag
tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg
atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatggaagg
aaaatttgcttggacctgcaagccccgctgtacaagaaaataattaagaaacttttggag
agttag

KEGG   Homo sapiens (human): 5197Help
Entry
5197              CDS       T01001                                 

Gene name
PF4V1, CXCL4L1, CXCL4V1, PF4-ALT, PF4A, SCYB4V1
Definition
(RefSeq) platelet factor 4 variant 1
  KO
K05407  platelet factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5197 (PF4V1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    5197 (PF4V1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    5197 (PF4V1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5197 (PF4V1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5197 (PF4V1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   5197 (PF4V1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   5197 (PF4V1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 5197
NCBI-ProteinID: NP_002611
OMIM: 173461
HGNC: 8862
Ensembl: ENSG00000109272
Vega: OTTHUMG00000130177
Pharos: P10720(Tbio)
UniProt: P10720
LinkDB All DBs
Structure
PDB: 

Position
4q13.3
AA seq 104 aa AA seqDB search
MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITS
LEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgcagccaggtcccgcctcacccgcgccacccgccaggagatgctgttcttg
gcgttgctgctcctgccagttgtggtcgccttcgccagagctgaagctgaagaagatggg
gacctgcagtgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagc
ctggaggtgatcaaggccggaccccactgccccactgcccaactcatagccacgctgaag
aatgggaggaaaatttgcttggatctgcaagccctgctgtacaagaaaatcattaaggaa
catttggagagttag

KEGG   Homo sapiens (human): 5473Help
Entry
5473              CDS       T01001                                 

Gene name
PPBP, B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1
Definition
(RefSeq) pro-platelet basic protein
  KO
K10029  platelet basic protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5473 (PPBP)
   04061 Viral protein interaction with cytokine and cytokine receptor
    5473 (PPBP)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    5473 (PPBP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5473 (PPBP)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   5473 (PPBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 5473
NCBI-ProteinID: NP_002695
OMIM: 121010
HGNC: 9240
Ensembl: ENSG00000163736
Vega: OTTHUMG00000130008
Pharos: P02775(Tbio)
UniProt: P02775
LinkDB All DBs
Structure
PDB: 

Position
4q13.3
AA seq 128 aa AA seqDB search
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAE
LRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKK
LAGDESAD
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcagacttgataccaccccttcctgtaacagtgcgagaccacttcatgccttg
caggtgctgctgcttctgtcattgctgctgactgctctggcttcctccaccaaaggacaa
actaagagaaacttggcgaaaggcaaagaggaaagtctagacagtgacttgtatgctgaa
ctccgctgcatgtgtataaagacaacctctggaattcatcccaaaaacatccaaagtttg
gaagtgatcgggaaaggaacccattgcaaccaagtcgaagtgatagccacactgaaggat
gggaggaaaatctgcctggacccagatgctcccagaatcaagaaaattgtacagaaaaaa
ttggcaggtgatgaatctgctgattaa

KEGG   Homo sapiens (human): 56477Help
Entry
56477             CDS       T01001                                 

Gene name
CCL28, CCK1, MEC, SCYA28
Definition
(RefSeq) C-C motif chemokine ligand 28
  KO
K05513  C-C motif chemokine 28
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56477 (CCL28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    56477 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    56477 (CCL28)
   04062 Chemokine signaling pathway
    56477 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    56477 (CCL28)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   56477 (CCL28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 56477
NCBI-ProteinID: NP_001288802
OMIM: 605240
HGNC: 17700
Ensembl: ENSG00000151882
Vega: OTTHUMG00000094811
Pharos: Q9NRJ3(Tbio)
UniProt: Q9NRJ3 A0N0Q3
LinkDB All DBs
Structure
PDB: 

Position
5p12
AA seq 127 aa AA seqDB search
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL
AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET
YGHKTPY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagagaggactcgccatcgtggccttggctgtctgtgcggccctacatgcctca
gaagccatacttcccattgcctccagctgttgcacggaggtttcacatcatatttccaga
aggctcctggaaagagtgaatatgtgtcgcatccagagagctgatggggattgtgacttg
gctgctgtcatccttcatgtcaagcgcagaagaatctgtgtcagcccgcacaaccatact
gttaagcagtggatgaaagtgcaagctgccaagaaaaatggtaaaggaaatgtttgccac
aggaagaaacaccatggcaagaggaacagtaacagggcacatcaggggaaacacgaaaca
tacggccataaaactccttattag

KEGG   Homo sapiens (human): 58191Help
Entry
58191             CDS       T01001                                 

Gene name
CXCL16, CXCLG16, SR-PSOX, SRPSOX
Definition
(RefSeq) C-X-C motif chemokine ligand 16
  KO
K10035  C-X-C motif chemokine 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    58191 (CXCL16)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    58191 (CXCL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    58191 (CXCL16)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   58191 (CXCL16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FeThRed_A zf-BED
Motif
Other DBs
NCBI-GeneID: 58191
NCBI-ProteinID: NP_001094282
OMIM: 605398
HGNC: 16642
Ensembl: ENSG00000161921
Vega: OTTHUMG00000090761
Pharos: Q9H2A7(Tbio)
UniProt: Q9H2A7
LinkDB All DBs
Position
17p13.2
AA seq 273 aa AA seqDB search
MSGSQSEVAPSPQSPRSPEMGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCG
KRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKE
CGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSD
KELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAA
LSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggagtcagagcgaggtggctccatccccgcagagtccgcggagccccgagatg
ggacgggacttgcggcccgggtcccgcgtgctcctgctcctgcttctgctcctgctggtg
tacctgactcagccaggcaatggcaacgagggcagcgtcactggaagttgttattgtggt
aaaagaatttcttccgactccccgccatcggttcagttcatgaatcgtctccggaaacac
ctgagagcttaccatcggtgtctatactacacgaggttccagctcctttcctggagcgtg
tgtgggggcaacaaggacccatgggttcaggaattgatgagctgtcttgatctcaaagaa
tgtggacatgcttactcggggattgtggcccaccagaagcatttacttcctaccagcccc
ccaatttctcaggcctcagagggggcatcttcagatatccacacccctgcccagatgctc
ctgtccaccttgcagtccactcagcgccccaccctcccagtaggatcactgtcctcggac
aaagagctcactcgtcccaatgaaaccaccattcacactgcgggccacagtctggcagct
gggcctgaggctggggagaaccagaagcagccggaaaaaaatgctggtcccacagccagg
acatcagccacagtgccagtcctgtgcctcctggccatcatcttcatcctcaccgcagcc
ctttcctatgtgctgtgcaagaggaggagggggcagtcaccgcagtcctctccagatctg
ccggttcattatatacctgtggcacctgactctaatacctga

KEGG   Homo sapiens (human): 6346Help
Entry
6346              CDS       T01001                                 

Gene name
CCL1, I-309, P500, SCYA1, SISe, TCA3
Definition
(RefSeq) C-C motif chemokine ligand 1
  KO
K05514  C-C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06124  Chemokine signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6346 (CCL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6346 (CCL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6346 (CCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6346 (CCL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6346 (CCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 Lectin_leg-like
Motif
Other DBs
NCBI-GeneID: 6346
NCBI-ProteinID: NP_002972
OMIM: 182281
HGNC: 10609
Ensembl: ENSG00000108702
Vega: OTTHUMG00000132888
Pharos: P22362(Tbio)
UniProt: P22362
LinkDB All DBs
Position
17q12
AA seq 96 aa AA seqDB search
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcatcaccacagccctggtgtgcttgctgctagctgggatgtggccggaagat
gtggacagcaagagcatgcaggtacccttctccagatgttgcttctcatttgcggagcaa
gagattcccctgagggcaatcctgtgttacagaaataccagctccatctgctccaatgag
ggcttaatattcaagctgaagagaggcaaagaggcctgcgccttggacacagttggatgg
gttcagaggcacagaaaaatgctgaggcactgcccgtcaaaaagaaaatga

KEGG   Homo sapiens (human): 6347Help
Entry
6347              CDS       T01001                                 

Gene name
CCL2, GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
Definition
(RefSeq) C-C motif chemokine ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06123  TNF signaling (virus)
nt06124  Chemokine signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
Drug target
Bindarit: D03116
Carlumab: D09877
Pirfenidone: D01583
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6347 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6347 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6347 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    6347 (CCL2)
   04657 IL-17 signaling pathway
    6347 (CCL2)
   04062 Chemokine signaling pathway
    6347 (CCL2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6347 (CCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6347 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6347 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    6347 (CCL2)
  09172 Infectious disease: viral
   05164 Influenza A
    6347 (CCL2)
   05168 Herpes simplex virus 1 infection
    6347 (CCL2)
   05163 Human cytomegalovirus infection
    6347 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    6347 (CCL2)
   05142 Chagas disease (American trypanosomiasis)
    6347 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6347 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6347 (CCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6347 (CCL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6347 (CCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6347
NCBI-ProteinID: NP_002973
OMIM: 158105
HGNC: 10618
Ensembl: ENSG00000108691
Vega: OTTHUMG00000132887
Pharos: P13500(Tchem)
UniProt: P13500
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 99 aa AA seqDB search
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctctgccgcccttctgtgcctgctgctcatagcagccaccttcattccccaa
gggctcgctcagccagatgcaatcaatgccccagtcacctgctgttataacttcaccaat
aggaagatctcagtgcagaggctcgcgagctatagaagaatcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag
aagtgggttcaggattccatggaccacctggacaagcaaacccaaactccgaagacttga

KEGG   Homo sapiens (human): 6348Help
Entry
6348              CDS       T01001                                 

Gene name
CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
Definition
(RefSeq) C-C motif chemokine ligand 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
Network
nt06124  Chemokine signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6348 (CCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6348 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6348 (CCL3)
   04062 Chemokine signaling pathway
    6348 (CCL3)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6348 (CCL3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    6348 (CCL3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6348 (CCL3)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    6348 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6348 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6348 (CCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6348 (CCL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6348 (CCL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6348
NCBI-ProteinID: NP_002974
OMIM: 182283
HGNC: 10627
Ensembl: ENSG00000277632
Vega: OTTHUMG00000188413
Pharos: P10147(Tbio)
UniProt: P10147 A0N0R1
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 92 aa AA seqDB search
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag
ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacacctcccgg
cagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaagccc
ggtgtcatcttcctaaccaagcgaagccggcaggtctgtgctgaccccagtgaggagtgg
gtccagaaatatgtcagcgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6349Help
Entry
6349              CDS       T01001                                 

Gene name
CCL3L1, 464.2, D17S1718, G0S19-2, LD78, LD78-beta(1-70), LD78BETA, MIP1AP, SCYA3L, SCYA3L1
Definition
(RefSeq) C-C motif chemokine ligand 3 like 1
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6349 (CCL3L1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6349 (CCL3L1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6349 (CCL3L1)
   04062 Chemokine signaling pathway
    6349 (CCL3L1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6349 (CCL3L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    6349 (CCL3L1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6349 (CCL3L1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    6349 (CCL3L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6349 (CCL3L1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6349 (CCL3L1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6349 (CCL3L1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6349 (CCL3L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6349
NCBI-ProteinID: NP_066286
OMIM: 601395
HGNC: 10628
Pharos: P16619(Tbio)
UniProt: P16619
LinkDB All DBs
Position
17q21.1
AA seq 93 aa AA seqDB search
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6351Help
Entry
6351              CDS       T01001                                 

Gene name
CCL4, ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4
Definition
(RefSeq) C-C motif chemokine ligand 4
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05132  Salmonella infection
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6351 (CCL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6351 (CCL4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6351 (CCL4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6351 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    6351 (CCL4)
   04062 Chemokine signaling pathway
    6351 (CCL4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    6351 (CCL4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6351 (CCL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6351 (CCL4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6351 (CCL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6351
NCBI-ProteinID: NP_002975
OMIM: 182284
HGNC: 10630
Ensembl: ENSG00000275302
Vega: OTTHUMG00000188414
Pharos: P13236(Tbio)
UniProt: P13236
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 92 aa AA seqDB search
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcatgctagtagctgccttctgctctcca
gcgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaagcaagcaagtctgtgctgatcccagtgaatcc
tgggtccaggagtacgtgtatgacctggaactgaactga

KEGG   Homo sapiens (human): 6352Help
Entry
6352              CDS       T01001                                 

Gene name
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
Definition
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
hsa05020  Prion diseases
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05323  Rheumatoid arthritis
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00429  HCMV UL22A to CCR5-GNB/G-PLCB/G-PKC signaling pathway
Disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6352 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6352 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6352 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6352 (CCL5)
   04621 NOD-like receptor signaling pathway
    6352 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    6352 (CCL5)
   04062 Chemokine signaling pathway
    6352 (CCL5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6352 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion diseases
    6352 (CCL5)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6352 (CCL5)
  09172 Infectious disease: viral
   05164 Influenza A
    6352 (CCL5)
   05168 Herpes simplex virus 1 infection
    6352 (CCL5)
   05163 Human cytomegalovirus infection
    6352 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    6352 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6352 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6352 (CCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6352 (CCL5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6352 (CCL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6352
NCBI-ProteinID: NP_002976
OMIM: 187011
HGNC: 10632
Ensembl: ENSG00000271503
Vega: OTTHUMG00000188396
Pharos: P13501(Tchem)
UniProt: P13501 D0EI67
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 91 aa AA seqDB search
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctag

KEGG   Homo sapiens (human): 6354Help
Entry
6354              CDS       T01001                                 

Gene name
CCL7, FIC, MARC, MCP-3, MCP3, NC28, SCYA6, SCYA7
Definition
(RefSeq) C-C motif chemokine ligand 7
  KO
K05509  C-C motif chemokine 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6354 (CCL7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6354 (CCL7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6354 (CCL7)
   04062 Chemokine signaling pathway
    6354 (CCL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6354 (CCL7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6354 (CCL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 GPR15L
Motif
Other DBs
NCBI-GeneID: 6354
NCBI-ProteinID: NP_006264
OMIM: 158106
HGNC: 10634
Ensembl: ENSG00000108688
Vega: OTTHUMG00000132889
Pharos: P80098(Tbio)
UniProt: P80098
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 99 aa AA seqDB search
MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctctgcagcacttctgtgtctgctgctcacagcagctgctttcagcccccag
gggcttgctcagccagttgggattaatacttcaactacctgctgctacagatttatcaat
aagaaaatccctaagcagaggctggagagctacagaaggaccaccagtagccactgtccc
cgggaagctgtaatcttcaagaccaaactggacaaggagatctgtgctgaccccacacag
aagtgggtccaggactttatgaagcacctggacaagaaaacccaaactccaaagctttga

KEGG   Homo sapiens (human): 6355Help
Entry
6355              CDS       T01001                                 

Gene name
CCL8, HC14, MCP-2, MCP2, SCYA10, SCYA8
Definition
(RefSeq) C-C motif chemokine ligand 8
  KO
K16596  C-C motif chemokine 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6355 (CCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6355 (CCL8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6355 (CCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6355 (CCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6355 (CCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 GPR15L
Motif
Other DBs
NCBI-GeneID: 6355
NCBI-ProteinID: NP_005614
OMIM: 602283
HGNC: 10635
Ensembl: ENSG00000108700
Vega: OTTHUMG00000132883
Pharos: P80075(Tbio)
UniProt: P80075
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 99 aa AA seqDB search
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttctgcagcgcttctgtgcctgctgctcatggcagccactttcagccctcag
ggacttgctcagccagattcagtttccattccaatcacctgctgctttaacgtgatcaat
aggaaaattcctatccagaggctggagagctacacaagaatcaccaacatccaatgtccc
aaggaagctgtgatcttcaagaccaaacggggcaaggaggtctgtgctgaccccaaggag
agatgggtcagggattccatgaagcatctggaccaaatatttcaaaatctgaagccatga

KEGG   Homo sapiens (human): 6356Help
Entry
6356              CDS       T01001                                 

Gene name
CCL11, SCYA11
Definition
(RefSeq) C-C motif chemokine ligand 11
  KO
K16597  C-C motif chemokine 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa05310  Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6356 (CCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6356 (CCL11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6356 (CCL11)
   04062 Chemokine signaling pathway
    6356 (CCL11)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    6356 (CCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6356 (CCL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6356 (CCL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 Tetraspanin
Motif
Other DBs
NCBI-GeneID: 6356
NCBI-ProteinID: NP_002977
OMIM: 601156
HGNC: 10610
Ensembl: ENSG00000172156
Vega: OTTHUMG00000132884
Pharos: P51671(Tbio)
UniProt: P51671 Q6I9T4
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 97 aa AA seqDB search
MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgcagcacttctgtggctgctgctcatagcagctgccttcagcccccag
gggctcgctgggccagcttctgtcccaaccacctgctgctttaacctggccaataggaag
ataccccttcagcgactagagagctacaggagaatcaccagtggcaaatgtccccagaaa
gctgtgatcttcaagaccaaactggccaaggatatctgtgccgaccccaagaagaagtgg
gtgcaggattccatgaagtatctggaccaaaaatctccaactccaaagccataa

KEGG   Homo sapiens (human): 6357Help
Entry
6357              CDS       T01001                                 

Gene name
CCL13, CKb10, MCP-4, NCC-1, NCC1, SCYA13, SCYL1
Definition
(RefSeq) C-C motif chemokine ligand 13
  KO
K16595  C-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6357 (CCL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6357 (CCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6357 (CCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6357 (CCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6357 (CCL13)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6357 (CCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6357 (CCL13)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6357 (CCL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 ATXN-1_C
Motif
Other DBs
NCBI-GeneID: 6357
NCBI-ProteinID: NP_005399
OMIM: 601391
HGNC: 10611
Ensembl: ENSG00000181374
Vega: OTTHUMG00000132890
Pharos: Q99616(Tbio)
UniProt: Q99616
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 98 aa AA seqDB search
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ
KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctctgcagtgcttctgtgcctgctgctcatgacagcagctttcaacccccag
ggacttgctcagccagatgcactcaacgtcccatctacttgctgcttcacatttagcagt
aagaagatctccttgcagaggctgaagagctatgtgatcaccaccagcaggtgtccccag
aaggctgtcatcttcagaaccaaactgggcaaggagatctgtgctgacccaaaggagaag
tgggtccagaattatatgaaacacctgggccggaaagctcacaccctgaagacttga

KEGG   Homo sapiens (human): 6358Help
Entry
6358              CDS       T01001                                 

Gene name
CCL14, CC-1, CC-3, CKB1, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14
Definition
(RefSeq) C-C motif chemokine ligand 14
  KO
K21092  C-C motif chemokine 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6358 (CCL14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6358 (CCL14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6358 (CCL14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6358 (CCL14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6358 (CCL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6358
NCBI-ProteinID: NP_116739
OMIM: 601392
HGNC: 10612
Ensembl: ENSG00000276409
Vega: OTTHUMG00000188403
Pharos: Q16627(Tbio)
UniProt: Q16627
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 93 aa AA seqDB search
MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCS
KPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctccgtggctgccattcccttcttcctcctcatcaccatcgccctagggacc
aagactgaatcctcctcacggggaccttaccacccctcagagtgctgcttcacctacact
acctacaagatcccgcgtcagcggattatggattactatgagaccaacagccagtgctcc
aagcccggaattgtcttcatcaccaaaaggggccattccgtctgtaccaaccccagtgac
aagtgggtccaggactatatcaaggacatgaaggagaactga

KEGG   Homo sapiens (human): 6359Help
Entry
6359              CDS       T01001                                 

Gene name
CCL15, HCC-2, HMRP-2B, LKN-1, LKN1, MIP-1_delta, MIP-1D, MIP-5, MRP-2B, NCC-3, NCC3, SCYA15, SCYL3, SY15
Definition
(RefSeq) C-C motif chemokine ligand 15
  KO
K05511  C-C motif chemokine 15/23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6359 (CCL15)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6359 (CCL15)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6359 (CCL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6359 (CCL15)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6359 (CCL15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6359
NCBI-ProteinID: NP_116741
OMIM: 601393
HGNC: 10613
Ensembl: ENSG00000275718
Vega: OTTHUMG00000188406
Pharos: Q16663(Tbio)
UniProt: Q16663 A0A0B4J2E2
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 113 aa AA seqDB search
MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQ
SIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctcctgcctcatgcttgttgctgtccttggatcccag
gcccagttcacaaatgatgcagagacagagttaatgatgtcaaagcttccactggaaaat
ccagtagttctgaacagctttcactttgctgctgactgctgcacctcctacatctcacaa
agcatcccgtgttcactcatgaaaagttattttgaaacgagcagcgagtgctccaagcca
ggtgtcatattcctcaccaagaaggggcggcaagtctgtgccaaacccagtggtccggga
gttcaggattgcatgaaaaagctgaagccctactcaatataa

KEGG   Homo sapiens (human): 6360Help
Entry
6360              CDS       T01001                                 

Gene name
CCL16, CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4
Definition
(RefSeq) C-C motif chemokine ligand 16
  KO
K21093  C-C motif chemokine 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6360 (CCL16)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6360 (CCL16)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6360 (CCL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6360 (CCL16)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6360 (CCL16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6360
NCBI-ProteinID: NP_004581
OMIM: 601394
HGNC: 10614
Ensembl: ENSG00000275152
Vega: OTTHUMG00000188402
Pharos: O15467(Tbio)
UniProt: O15467
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 120 aa AA seqDB search
MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNC
HLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgaggctgccctgtctctccttgtcctcatccttatcattacttcggct
tctcgcagccagccaaaagttcctgagtgggtgaacaccccatccacctgctgcctgaag
tattatgagaaagtgttgccaaggagactagtggtgggatacagaaaggccctcaactgt
cacctgccagcaatcatcttcgtcaccaagaggaaccgagaagtctgcaccaaccccaat
gacgactgggtccaagagtacatcaaggatcccaacctacctttgctgcctaccaggaac
ttgtccacggttaaaattattacagcaaagaatggtcaaccccagctcctcaactcccag
tga

KEGG   Homo sapiens (human): 6361Help
Entry
6361              CDS       T01001                                 

Gene name
CCL17, A-152E5.3, ABCD-2, SCYA17, TARC
Definition
(RefSeq) C-C motif chemokine ligand 17
  KO
K21083  C-C motif chemokine 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6361 (CCL17)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6361 (CCL17)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    6361 (CCL17)
   04657 IL-17 signaling pathway
    6361 (CCL17)
   04062 Chemokine signaling pathway
    6361 (CCL17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6361 (CCL17)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6361 (CCL17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6361
NCBI-ProteinID: NP_002978
OMIM: 601520
HGNC: 10615
Ensembl: ENSG00000102970
Vega: OTTHUMG00000133468
Pharos: Q92583(Tbio)
UniProt: Q92583
LinkDB All DBs
Structure
PDB: 

Position
16q21
AA seq 94 aa AA seqDB search
MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
AIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggccccactgaagatgctggccctggtcaccctcctcctgggggcttctctgcagcac
atccacgcagctcgagggaccaatgtgggccgggagtgctgcctggagtacttcaaggga
gccattccccttagaaagctgaagacgtggtaccagacatctgaggactgctccagggat
gccatcgtttttgtaactgtgcagggcagggccatctgttcggaccccaacaacaagaga
gtgaagaatgcagttaaatacctgcaaagccttgagaggtcttga

KEGG   Homo sapiens (human): 6362Help
Entry
6362              CDS       T01001                                 

Gene name
CCL18, AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18
Definition
(RefSeq) C-C motif chemokine ligand 18
  KO
K21094  C-C motif chemokine 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6362 (CCL18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6362 (CCL18)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6362 (CCL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6362 (CCL18)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6362 (CCL18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6362
NCBI-ProteinID: NP_002979
OMIM: 603757
HGNC: 10616
Ensembl: ENSG00000275385
Vega: OTTHUMG00000188410
Pharos: P55774(Tbio)
UniProt: P55774
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 89 aa AA seqDB search
MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVI
LLTKRGRQICADPNKKWVQKYISDLKLNA
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaagggccttgcagctgccctccttgtcctcgtctgcaccatggccctctgctcctgt
gcacaagttggtaccaacaaagagctctgctgcctcgtctatacctcctggcagattcca
caaaagttcatagttgactattctgaaaccagcccccagtgccccaagccaggtgtcatc
ctcctaaccaagagaggccggcagatctgtgctgaccccaataagaagtgggtccagaaa
tacatcagcgacctgaagctgaatgcctga

KEGG   Homo sapiens (human): 6363Help
Entry
6363              CDS       T01001                                 

Gene name
CCL19, CKb11, ELC, MIP-3b, MIP3B, SCYA19
Definition
(RefSeq) C-C motif chemokine ligand 19
  KO
K05512  C-C motif chemokine 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6363 (CCL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6363 (CCL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6363 (CCL19)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6363 (CCL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6363 (CCL19)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6363 (CCL19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6363
NCBI-ProteinID: NP_006265
OMIM: 602227
HGNC: 10617
Ensembl: ENSG00000172724
Vega: OTTHUMG00000019833
Pharos: Q99731(Tbio)
UniProt: Q99731 Q6IBD6
LinkDB All DBs
Structure
PDB: 

Position
9p13.3
AA seq 98 aa AA seqDB search
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV
VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctactggccctcagcctgctggttctctggacttccccagccccaactctg
agtggcaccaatgatgctgaagactgctgcctgtctgtgacccagaaacccatccctggg
tacatcgtgaggaacttccactaccttctcatcaaggatggctgcagggtgcctgctgta
gtgttcaccacactgaggggccgccagctctgtgcacccccagaccagccctgggtagaa
cgcatcatccagagactgcagaggacctcagccaagatgaagcgccgcagcagttaa

KEGG   Homo sapiens (human): 6364Help
Entry
6364              CDS       T01001                                 

Gene name
CCL20, CKb4, Exodus, LARC, MIP-3-alpha, MIP-3a, MIP3A, SCYA20, ST38
Definition
(RefSeq) C-C motif chemokine ligand 20
  KO
K14625  C-C motif chemokine 20
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6364 (CCL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6364 (CCL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6364 (CCL20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6364 (CCL20)
   04062 Chemokine signaling pathway
    6364 (CCL20)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6364 (CCL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6364 (CCL20)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6364 (CCL20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6364
NCBI-ProteinID: NP_004582
OMIM: 601960
HGNC: 10619
Ensembl: ENSG00000115009
Vega: OTTHUMG00000133189
Pharos: P78556(Tbio)
UniProt: P78556
LinkDB All DBs
Structure
PDB: 

Position
2q36.3
AA seq 96 aa AA seqDB search
MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDI
NAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtgctgtaccaagagtttgctcctggctgctttgatgtcagtgctgctactccacctc
tgcggcgaatcagaagcagcaagcaactttgactgctgtcttggatacacagaccgtatt
cttcatcctaaatttattgtgggcttcacacggcagctggccaatgaaggctgtgacatc
aatgctatcatctttcacacaaagaaaaagttgtctgtgtgcgcaaatccaaaacagact
tgggtgaaatatattgtgcgtctcctcagtaaaaaagtcaagaacatgtaa

KEGG   Homo sapiens (human): 6366Help
Entry
6366              CDS       T01001                                 

Gene name
CCL21, 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4
Definition
(RefSeq) C-C motif chemokine ligand 21
  KO
K16062  C-C motif chemokine 21
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6366 (CCL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6366 (CCL21)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6366 (CCL21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6366 (CCL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6366 (CCL21)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6366 (CCL21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6366
NCBI-ProteinID: NP_002980
OMIM: 602737
HGNC: 10620
Ensembl: ENSG00000137077
Vega: OTTHUMG00000019838
Pharos: O00585(Tbio)
UniProt: O00585
LinkDB All DBs
Structure
PDB: 

Position
9p13.3
AA seq 134 aa AA seqDB search
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
GCKRTERSQTPKGP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtcactggctctgagcctccttatcctggttctggcctttggcatccccagg
acccaaggcagtgatggaggggctcaggactgttgcctcaagtacagccaaaggaagatt
cccgccaaggttgtccgcagctaccggaagcaggaaccaagcttaggctgctccatccca
gctatcctgttcttgccccgcaagcgctctcaggcagagctatgtgcagacccaaaggag
ctctgggtgcagcagctgatgcagcatctggacaagacaccatccccacagaaaccagcc
cagggctgcaggaaggacaggggggcctccaagactggcaagaaaggaaagggctccaaa
ggctgcaagaggactgagcggtcacagacccctaaagggccatag

KEGG   Homo sapiens (human): 6367Help
Entry
6367              CDS       T01001                                 

Gene name
CCL22, A-152E5.1, ABCD-1, DC/B-CK, MDC, SCYA22, STCP-1
Definition
(RefSeq) C-C motif chemokine ligand 22
  KO
K21095  C-C motif chemokine 22
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6367 (CCL22)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6367 (CCL22)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    6367 (CCL22)
   04062 Chemokine signaling pathway
    6367 (CCL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6367 (CCL22)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6367 (CCL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6367
NCBI-ProteinID: NP_002981
OMIM: 602957
HGNC: 10621
Ensembl: ENSG00000102962
Vega: OTTHUMG00000133454
Pharos: O00626(Tbio)
UniProt: O00626
LinkDB All DBs
Position
16q21
AA seq 93 aa AA seqDB search
MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSC
PRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcctacagactgcactcctggttgtcctcgtcctccttgctgtggcgcttcaa
gcaactgaggcaggcccctacggcgccaacatggaagacagcgtctgctgccgtgattac
gtccgttaccgtctgcccctgcgcgtggtgaaacacttctactggacctcagactcctgc
ccgaggcctggcgtggtgttgctaaccttcagggataaggagatctgtgccgatcccaga
gtgccctgggtgaagatgattctcaataagctgagccaatga

KEGG   Homo sapiens (human): 6368Help
Entry
6368              CDS       T01001                                 

Gene name
CCL23, CK-BETA-8, CKb8, Ckb-8, Ckb-8-1, MIP-3, MIP3, MPIF-1, SCYA23, hmrp-2a
Definition
(RefSeq) C-C motif chemokine ligand 23
  KO
K05511  C-C motif chemokine 15/23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6368 (CCL23)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6368 (CCL23)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6368 (CCL23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6368 (CCL23)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6368 (CCL23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 6368
NCBI-ProteinID: NP_665905
OMIM: 602494
HGNC: 10622
Ensembl: ENSG00000274736
Vega: OTTHUMG00000188409
Pharos: P55773(Tbio)
UniProt: P55773
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 120 aa AA seqDB search
MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTP
RSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctcctgcctcatgcttgttactgcccttggatcccag
gcccgggtcacaaaagatgcagagacagagttcatgatgtcaaagcttccattggaaaat
ccagtacttctggacagattccatgctactagtgctgactgctgcatctcctacacccca
cgaagcatcccgtgttcactcctggagagttactttgaaacgaacagcgagtgctccaag
ccgggtgtcatcttcctcaccaagaaggggcgacgtttctgtgccaaccccagtgataag
caagttcaggtttgcatgagaatgctgaagctggacacacggatcaagaccaggaagaat
tga

KEGG   Homo sapiens (human): 6369Help
Entry
6369              CDS       T01001                                 

Gene name
CCL24, Ckb-6, MPIF-2, MPIF2, SCYA24
Definition
(RefSeq) C-C motif chemokine ligand 24
  KO
K21097  C-C motif chemokine 24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6369 (CCL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6369 (CCL24)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6369 (CCL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6369 (CCL24)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6369 (CCL24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6369
NCBI-ProteinID: NP_002982
OMIM: 602495
HGNC: 10623
Ensembl: ENSG00000106178
Vega: OTTHUMG00000156635
Pharos: O00175(Tbio)
UniProt: O00175
LinkDB All DBs
Structure
PDB: 

Position
7q11.23
AA seq 119 aa AA seqDB search
MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLK
AGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcctgatgaccatagtaaccagccttctgttccttggtgtctgtgcccaccac
atcatccctacgggctctgtggtcatcccctctccctgctgcatgttctttgtttccaag
agaattcctgagaaccgagtggtcagctaccagctgtccagcaggagcacatgcctcaag
gcaggagtgatcttcaccaccaagaagggccagcagttctgtggcgaccccaagcaggag
tgggtccagaggtacatgaagaacctggacgccaagcagaagaaggcttcccctagggcc
agggcagtggctgtcaagggccctgtccagagatatcctggcaaccaaaccacctgctaa

KEGG   Homo sapiens (human): 6370Help
Entry
6370              CDS       T01001                                 

Gene name
CCL25, Ckb15, SCYA25, TECK
Definition
(RefSeq) C-C motif chemokine ligand 25
  KO
K13072  C-C motif chemokine 25
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6370 (CCL25)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6370 (CCL25)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    6370 (CCL25)
   04062 Chemokine signaling pathway
    6370 (CCL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6370 (CCL25)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6370 (CCL25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6370
NCBI-ProteinID: NP_005615
OMIM: 602565
HGNC: 10624
Ensembl: ENSG00000131142
Vega: OTTHUMG00000141287
Pharos: O15444(Tbio)
UniProt: O15444
LinkDB All DBs
Position
19p13.2
AA seq 150 aa AA seqDB search
MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNL
PAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSG
NSKLSSSKFSNPISSSKRNVSLLISANSGL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtggctcctggcctgcctggtggccggcttcctgggagcctgggcccccgct
gtccacacccaaggtgtctttgaggactgctgcctggcctaccactaccccattgggtgg
gctgtgctccggcgcgcctggacttaccggatccaggaggtgagcgggagctgcaatctg
cctgctgcgatattctacctccccaagagacacaggaaggtgtgtgggaaccccaaaagc
agggaggtgcagagagccatgaagctcctggatgctcgaaataaggtttttgcaaagctc
caccacaacacgcagaccttccaagcaggccctcatgctgtaaagaagttgagttctgga
aactccaagttatcatcgtccaagtttagcaatcccatcagcagcagtaagaggaatgtc
tccctcctgatatcagctaattcaggactgtga

KEGG   Homo sapiens (human): 6372Help
Entry
6372              CDS       T01001                                 

Gene name
CXCL6, CKA-3, GCP-2, GCP2, SCYB6
Definition
(RefSeq) C-X-C motif chemokine ligand 6
  KO
K05506  C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa05133  Pertussis
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6372 (CXCL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6372 (CXCL6)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6372 (CXCL6)
   04062 Chemokine signaling pathway
    6372 (CXCL6)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6372 (CXCL6)
  09171 Infectious disease: bacterial
   05133 Pertussis
    6372 (CXCL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6372 (CXCL6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6372 (CXCL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6372
NCBI-ProteinID: NP_002984
OMIM: 138965
HGNC: 10643
Ensembl: ENSG00000124875
Vega: OTTHUMG00000130010
Pharos: P80162(Tbio)
UniProt: P80162
LinkDB All DBs
Position
4q13.3
AA seq 114 aa AA seqDB search
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcccgtccagccgcgcggcccgtgtcccgggtccttcgggctccttgtgcgcg
ctgctcgcgctgctgctcctgctgacgccgccggggcccctcgccagcgctggtcctgtc
tctgctgtgctgacagagctgcgttgcacttgtttacgcgttacgctgagagtaaacccc
aaaacgattggtaaactgcaggtgttccccgcaggcccgcagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaagcaagtttgtctggacccggaagccccttttctaaag
aaagtcatccagaaaattttggacagtggaaacaagaaaaactga

KEGG   Homo sapiens (human): 6373Help
Entry
6373              CDS       T01001                                 

Gene name
CXCL11, H174, I-TAC, IP-9, IP9, SCYB11, SCYB9B, b-R1
Definition
(RefSeq) C-X-C motif chemokine ligand 11
  KO
K12672  C-X-C motif chemokine 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6373 (CXCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6373 (CXCL11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6373 (CXCL11)
   04062 Chemokine signaling pathway
    6373 (CXCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6373 (CXCL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6373 (CXCL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6373
NCBI-ProteinID: NP_005400
OMIM: 604852
HGNC: 10638
Ensembl: ENSG00000169248
Vega: OTTHUMG00000130101
Pharos: O14625(Tbio)
UniProt: O14625
LinkDB All DBs
Position
4q21.1
AA seq 94 aa AA seqDB search
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKI
EVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaagggcatggctatagccttggctgtgatattgtgtgctacagttgttcaa
ggcttccccatgttcaaaagaggacgctgtctttgcataggccctggggtaaaagcagtg
aaagtggcagatattgagaaagcctccataatgtacccaagtaacaactgtgacaaaata
gaagtgattattaccctgaaagaaaataaaggacaacgatgcctaaatcccaaatcgaag
caagcaaggcttataatcaaaaaagttgaaagaaagaatttttaa

KEGG   Homo sapiens (human): 6374Help
Entry
6374              CDS       T01001                                 

Gene name
CXCL5, ENA-78, SCYB5
Definition
(RefSeq) C-X-C motif chemokine ligand 5
  KO
K05506  C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05133  Pertussis
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6374 (CXCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6374 (CXCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6374 (CXCL5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6374 (CXCL5)
   04062 Chemokine signaling pathway
    6374 (CXCL5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6374 (CXCL5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    6374 (CXCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6374 (CXCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6374 (CXCL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6374
NCBI-ProteinID: NP_002985
OMIM: 600324
HGNC: 10642
Ensembl: ENSG00000163735
Vega: OTTHUMG00000160871
Pharos: P42830(Tbio)
UniProt: P42830 Q6I9S7
LinkDB All DBs
Structure
PDB: 

Position
4q13.3
AA seq 114 aa AA seqDB search
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctgtccagccgcgcggcccgtgtccccggtccttcgagctccttgtgcgcg
ctgttggtgctgctgctgctgctgacgcagccagggcccatcgccagcgctggtcctgcc
gctgctgtgttgagagagctgcgttgcgtttgtttacagaccacgcaaggagttcatccc
aaaatgatcagtaatctgcaagtgttcgccataggcccacagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaaggaaatttgtcttgatccagaagccccttttctaaag
aaagtcatccagaaaattttggacggtggaaacaaggaaaactga

KEGG   Homo sapiens (human): 6375Help
Entry
6375              CDS       T01001                                 

Gene name
XCL1, ATAC, LPTN, LTN, SCM-1, SCM-1a, SCM1, SCM1A, SCYC1
Definition
(RefSeq) X-C motif chemokine ligand 1
  KO
K05507  C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6375 (XCL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6375 (XCL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6375 (XCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6375 (XCL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6375 (XCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 PHtD_u1
Motif
Other DBs
NCBI-GeneID: 6375
NCBI-ProteinID: NP_002986
OMIM: 600250
HGNC: 10645
Ensembl: ENSG00000143184
Vega: OTTHUMG00000034548
Pharos: P47992(Tbio)
UniProt: P47992
LinkDB All DBs
Structure
PDB: 

Position
1q24.2
AA seq 114 aa AA seqDB search
MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagacttctcatcctggccctccttggcatctgctctctcactgcatacattgtggaa
ggtgtagggagtgaagtctcagataagaggacctgtgtgagcctcactacccagcgactg
ccggttagcagaatcaagacctacaccatcacggaaggctccttgagagcagtaattttt
attaccaaacgtggcctaaaagtctgtgctgatccacaagccacatgggtgagagacgtg
gtcaggagcatggacaggaaatccaacaccagaaataacatgatccagaccaagccaaca
ggaacccagcaatcgaccaatacagctgtgactctgactggctag

KEGG   Homo sapiens (human): 6376Help
Entry
6376              CDS       T01001                                 

Gene name
CX3CL1, ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
Definition
(RefSeq) C-X3-C motif chemokine ligand 1
  KO
K05508  C-X3-C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04668  TNF signaling pathway
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Drug target
Quetmolimab: D11498
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6376 (CX3CL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6376 (CX3CL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6376 (CX3CL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6376 (CX3CL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6376 (CX3CL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6376 (CX3CL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6376 (CX3CL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6376
NCBI-ProteinID: NP_002987
OMIM: 601880
HGNC: 10647
Ensembl: ENSG00000006210
Vega: OTTHUMG00000133469
Pharos: P78423(Tbio)
UniProt: P78423 A0N0N7
LinkDB All DBs
Structure
PDB: 

Position
16q21
AA seq 397 aa AA seqDB search
MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK
RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG
MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA
PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF
TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctccgatatctctgtcgtggctgctccgcttggccaccttctgccatctgactgtc
ctgctggctggacagcaccacggtgtgacgaaatgcaacatcacgtgcagcaagatgaca
tcaaagatacctgtagctttgctcatccactatcaacagaaccaggcatcatgcggcaaa
cgcgcaatcatcttggagacgagacagcacaggctgttctgtgccgacccgaaggagcaa
tgggtcaaggacgcgatgcagcatctggaccgccaggctgctgccctaactcgaaatggc
ggcaccttcgagaagcagatcggcgaggtgaagcccaggaccacccctgccgccggggga
atggacgagtctgtggtcctggagcccgaagccacaggcgaaagcagtagcctggagccg
actccttcttcccaggaagcacagagggccctggggacctccccagagctgccgacgggc
gtgactggttcctcagggaccaggctccccccgacgccaaaggctcaggatggagggcct
gtgggcacggagcttttccgagtgcctcccgtctccactgccgccacgtggcagagttct
gctccccaccaacctgggcccagcctctgggctgaggcaaagacctctgaggccccgtcc
acccaggacccctccacccaggcctccactgcgtcctccccagccccagaggagaatgct
ccgtctgaaggccagcgtgtgtggggtcagggacagagccccaggccagagaactctctg
gagcgggaggagatgggtcccgtgccagcgcacacggatgccttccaggactgggggcct
ggcagcatggcccacgtctctgtggtccctgtctcctcagaagggacccccagcagggag
ccagtggcttcaggcagctggacccctaaggctgaggaacccatccatgccaccatggac
ccccagaggctgggcgtccttatcactcctgtccctgacgcccaggctgccacccggagg
caggcggtggggctgctggccttccttggcctcctcttctgcctgggggtggccatgttc
acctaccagagcctccagggctgccctcgaaagatggcaggagagatggcggagggcctt
cgctacatcccccggagctgtggtagtaattcatatgtcctggtgcccgtgtga

KEGG   Homo sapiens (human): 6387Help
Entry
6387              CDS       T01001                                 

Gene name
CXCL12, IRH, PBSF, SCYB12, SDF1, TLSF, TPAR1, SDF1A, SDF1B
Definition
(RefSeq) C-X-C motif chemokine ligand 12
  KO
K10031  C-X-C motif chemokine 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04360  Axon guidance
hsa04670  Leukocyte transendothelial migration
hsa04672  Intestinal immune network for IgA production
hsa04810  Regulation of actin cytoskeleton
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
hsa05323  Rheumatoid arthritis
Network
nt06124  Chemokine signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00433  CXCR4-GNB/G-RAC signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6387 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6387 (CXCL12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6387 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    6387 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    6387 (CXCL12)
   04672 Intestinal immune network for IgA production
    6387 (CXCL12)
   04062 Chemokine signaling pathway
    6387 (CXCL12)
  09158 Development and regeneration
   04360 Axon guidance
    6387 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6387 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6387 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6387 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6387 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6387 (CXCL12)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6387 (CXCL12)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6387 (CXCL12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6387
NCBI-ProteinID: NP_000600
OMIM: 600835
HGNC: 10672
Ensembl: ENSG00000107562
Vega: OTTHUMG00000018054
Pharos: P48061(Tbio)
UniProt: P48061
LinkDB All DBs
Structure
PDB: 

Position
10q11.21
AA seq 93 aa AA seqDB search
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaaggtcgtggtcgtgctggtcctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgta
gcccggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagaggttcaagatgtga

KEGG   Homo sapiens (human): 6846Help
Entry
6846              CDS       T01001                                 

Gene name
XCL2, SCM-1b, SCM1B, SCYC2
Definition
(RefSeq) X-C motif chemokine ligand 2
  KO
K22675  C motif chemokine 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6846 (XCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6846 (XCL2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6846 (XCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6846 (XCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6846 (XCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 PHtD_u1
Motif
Other DBs
NCBI-GeneID: 6846
NCBI-ProteinID: NP_003166
OMIM: 604828
HGNC: 10646
Ensembl: ENSG00000143185
Vega: OTTHUMG00000034549
Pharos: Q9UBD3(Tbio)
UniProt: Q9UBD3
LinkDB All DBs
Position
1q24.2
AA seq 114 aa AA seqDB search
MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagacttctcatcctggccctccttggcatctgctctctcactgcatacattgtggaa
ggtgtagggagtgaagtctcacataggaggacctgtgtgagcctcactacccagcgactg
ccagttagcagaatcaagacctacaccatcacggaaggctccttgagagcagtaattttt
attaccaaacgtggcctaaaagtctgtgctgatccacaagccacgtgggtgagagacgtg
gtcaggagcatggacaggaaatccaacaccagaaataacatgatccagaccaagccaaca
ggaacccagcaatcgaccaatacagctgtgaccctgactggctag

KEGG   Homo sapiens (human): 9547Help
Entry
9547              CDS       T01001                                 

Gene name
CXCL14, BMAC, BRAK, KEC, KS1, MIP-2g, MIP2G, NJAC, SCYB14
Definition
(RefSeq) C-X-C motif chemokine ligand 14
  KO
K10033  C-X-C motif chemokine 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9547 (CXCL14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    9547 (CXCL14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    9547 (CXCL14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9547 (CXCL14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   9547 (CXCL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 9547
NCBI-ProteinID: NP_004878
OMIM: 604186
HGNC: 10640
Ensembl: ENSG00000145824
Vega: OTTHUMG00000129139
Pharos: O95715(Tbio)
UniProt: O95715
LinkDB All DBs
Structure
PDB: 

Position
5q31.1
AA seq 111 aa AA seqDB search
MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgctcccacgccgcgcccctccggtcagcatgaggctcctggcggccgcgctg
ctcctgctgctgctggcgctgtacaccgcgcgtgtggacgggtccaaatgcaagtgctcc
cggaagggacccaagatccgctacagcgacgtgaagaagctggaaatgaagccaaagtac
ccgcactgcgaggagaagatggttatcatcaccaccaagagcgtgtccaggtaccgaggt
caggagcactgcctgcaccccaagctgcagagcaccaagcgcttcatcaagtggtacaac
gcctggaacgagaagcgcagggtctacgaagaatag

KEGG   Homo sapiens (human): 9560Help
Entry
9560              CDS       T01001                                 

Gene name
CCL4L2, AT744.2, CCL4L, SCYA4L, SCYQ4L2
Definition
(RefSeq) C-C motif chemokine ligand 4 like 2
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05132  Salmonella infection
hsa05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    9560 (CCL4L2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9560 (CCL4L2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    9560 (CCL4L2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    9560 (CCL4L2)
   04623 Cytosolic DNA-sensing pathway
    9560 (CCL4L2)
   04062 Chemokine signaling pathway
    9560 (CCL4L2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    9560 (CCL4L2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    9560 (CCL4L2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9560 (CCL4L2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   9560 (CCL4L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 9560
NCBI-ProteinID: NP_001278401
OMIM: 610757
HGNC: 24066
Ensembl: ENSG00000276070
Vega: OTTHUMG00000188420
Pharos: Q8NHW4(Tdark)
UniProt: Q8NHW4
LinkDB All DBs
Position
17q12
AA seq 96 aa AA seqDB search
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcgtgctagtagctgccttctgctctcta
gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggttgctgctccgggaaggatcccatccaccagagctgccccacatggacca
tggtcaggcagaggaagatgcctaccacaggcaagggataaagccagatga

DBGET integrated database retrieval system