KEGG   Homo sapiens (human): 10365
Entry
10365             CDS       T01001                                 

Gene name
KLF2, LKLF
Definition
(RefSeq) Kruppel like factor 2
  KO
K17845  krueppel-like factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04371  Apelin signaling pathway
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    10365 (KLF2)
   04068 FoxO signaling pathway
    10365 (KLF2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    10365 (KLF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10365 (KLF2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    10365 (KLF2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4
Other DBs
NCBI-GeneID: 10365
NCBI-ProteinID: NP_057354
OMIM: 602016
HGNC: 6347
Ensembl: ENSG00000127528
Vega: OTTHUMG00000182330
Pharos: Q9Y5W3(Tbio)
UniProt: Q9Y5W3
LinkDB
Position
19p13.11
AA seq 355 aa
MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEA
APEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRL
VKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDG
PARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAAR
GLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggcgctgagtgaacccatcctgccgtccttctccactttcgccagcccgtgccgcgag
cgcggcctgcaggagcgctggccgcgcgccgaacccgagtccggcggcaccgacgacgac
ctcaacagcgtgctggacttcatcctgtccatggggctggatggcctgggcgccgaggcc
gccccggagccgccgccgccgcccccgccgcctgcgttctattaccccgaacccggcgcg
cccccgccctacagcgcccccgcgggtggcctggtgtctgagctgctgcgacccgagctg
gatgcgccgctggggcccgcactgcacggccgctttctgctggcgccgcccggccgcctg
gtcaaggccgagccccctgaagcggacggcggcggcggctacggctgcgcccccgggctg
acccgtggaccgcgcggcctcaagcgcgagggcgccccgggcccggcggcttcgtgcatg
cgaggtcccgggggccgccccccgccgccgcccgacacaccgccgctcagccccgacggc
cccgcgcgcctgcccgcgcccggtccgcgcgcctccttcccgccgcctttcggtggccct
ggtttcggcgcgcccgggcccggcctgcattacgcgccgcctgcgcccccagccttcggt
ctcttcgacgacgcggccgccgccgcggcagccctgggcctggcgccccccgccgcccgc
ggtctcctcacgccgcctgcgtccccgctggagctgctggaggccaagccaaagcgcggc
cgccgctcttggccccgcaaacgcaccgccactcacacctgcagctacgcgggctgcggc
aagacctacaccaagagttcgcatctgaaggcgcatctgcgcacgcacacaggtgagaag
ccctaccactgcaactgggacggctgcggctggaagtttgcgcgctcagacgagctcacg
cgccactaccgaaagcacacgggccaccggccattccagtgccatctgtgcgatcgtgcc
ttctcgcgctccgatcacctggcgctgcacatgaaacggcacatgtag

DBGET integrated database retrieval system