KEGG   Homo sapiens (human): 10383
Entry
10383             CDS       T01001                                 

Gene name
TUBB4B, Beta2, LCAEOD, TUBB2, TUBB2C
Definition
(RefSeq) tubulin beta 4B class IVb
  KO
K07375  tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04540  Gap junction
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05130  Pathogenic Escherichia coli infection
Network
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01158  Mutation-caused aberrant DCTN1 to retrograde axonal transport
Drug target
Avanbulin: D11681
Batabulin (DG01412): D03059 D06560
Brentuximab vedotin: D09587<JP/US>
Cabazitaxel (DG00695): D09755 D10452<JP/US>
Cevipabulin (DG01413): D06576 D08889
Colchicine: D00570<JP/US>
Denintuzumab mafodotin: D11232
Docetaxel (DG00694): D02165<JP/US> D07866<JP/US>
Enfortumab vedotin: D11525<US>
Eribulin: D08914<JP/US>
Estramustine (DG00724): D02398 D04066 D06397<JP/US>
Glembatumumab vedotin: D09912
Indibulin: D10013
Ixabepilone: D04645<US>
Lexibulin: D10073
Lifastuzumab vedotin: D11238
Lisavanbulin: D11494
Maytansine: D04864
Mivobulin isethionate: D05062
Paclitaxel: D00491<JP/US>
Paclitaxel poliglumex: D05333
Podophyllotoxin: D05529<US>
Soblidotin: D01919
Taltobulin: D06001
Tasidotin hydrochloride: D06009
Trastuzumab emtansine: D09980<JP/US>
Verubulin (DG01411): D10029 D10030
Vinblastine (DG00689): D01068<JP/US> D08675
Vincristine (DG00690): D02197<JP/US> D08679
Vindesine (DG00691): D01769<JP> D06304
Vinepidine sulfate: D06305
Vinflunine: D09032
Vinglycinate sulfate: D06306
Vinleurosine sulfate: D06307
Vinorelbine (DG00692): D01935<JP/US> D08680
Vinrosidine sulfate: D06308
Vinzolidine sulfate: D06309
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    10383 (TUBB4B)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    10383 (TUBB4B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10383 (TUBB4B)
   05012 Parkinson disease
    10383 (TUBB4B)
   05014 Amyotrophic lateral sclerosis
    10383 (TUBB4B)
   05016 Huntington disease
    10383 (TUBB4B)
   05020 Prion disease
    10383 (TUBB4B)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10383 (TUBB4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10383 (TUBB4B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10383 (TUBB4B)
   04147 Exosome [BR:hsa04147]
    10383 (TUBB4B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     10383 (TUBB4B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    10383 (TUBB4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10383 (TUBB4B)
  Exosomal proteins of colorectal cancer cells
   10383 (TUBB4B)
  Exosomal proteins of bladder cancer cells
   10383 (TUBB4B)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 10383
NCBI-ProteinID: NP_006079
OMIM: 602660
HGNC: 20771
Ensembl: ENSG00000188229
Vega: OTTHUMG00000131783
Pharos: P68371(Tclin)
UniProt: P68371
LinkDB
Position
9q34.3
AA seq 445 aa
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagggaaatcgtgcacttgcaggccgggcagtgcggcaaccaaatcggcgccaagttt
tgggaggtgatcagcgatgagcacggcatcgaccccacgggcacctaccacggggacagc
gacctgcagctggaacgcatcaacgtgtactacaatgaggccaccggcggcaagtacgtg
ccccgcgccgtgctcgtggatctggagcccggcaccatggactccgtgcgctcggggccc
ttcgggcagatcttccggccggacaacttcgttttcggtcagagtggtgctgggaacaac
tgggccaaggggcactacacagaaggcgcggagctggtggactcggtgctggatgttgtg
agaaaggaggctgagagctgtgactgcctgcagggtttccagctgacccactccctgggt
ggggggactgggtctgggatgggtaccctcctcatcagcaagatccgggaggagtaccca
gacaggatcatgaacacgtttagtgtggtgccttcgcccaaagtgtcagacacagtggtg
gagccctacaacgccaccctctcagtccaccagctcgtagaaaacacagacgagacctac
tgcattgataacgaagctctctacgacatttgcttcagaaccctaaagctgaccacgccc
acctatggtgacctgaaccacctggtgtctgctaccatgagtggggtcaccacctgcctg
cgcttcccaggccagctcaatgctgacctgcggaagctggctgtgaacatggtcccgttt
ccccggctgcacttcttcatgcccggctttgccccactgaccagccggggcagccagcag
taccgggcgctgaccgtgcccgagctcacccagcagatgtttgatgccaagaacatgatg
gctgcctgcgacccccgccatggccgctacctgacggttgccgccgtgttcaggggccgc
atgtccatgaaggaggtggatgagcaaatgcttaatgtccaaaacaaaaacagcagctat
tttgttgagtggatccccaacaatgtgaaaacggctgtctgtgacatcccacctcggggg
ctaaaaatgtccgccaccttcattggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaatgacctggtgtcc
gagtaccagcagtaccaggatgccacagccgaggaggagggcgagttcgaggaggaggct
gaggaggaggtggcctag

DBGET integrated database retrieval system