KEGG   Homo sapiens (human): 103910
Entry
103910            CDS       T01001                                 

Gene name
MYL12B, MLC-B, MRLC2
Definition
(RefSeq) myosin light chain 12B
  KO
K12757  myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01074  Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway
N01130  Salmonella SopB to RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103910 (MYL12B)
   04530 Tight junction
    103910 (MYL12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103910 (MYL12B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103910 (MYL12B)
   04670 Leukocyte transendothelial migration
    103910 (MYL12B)
  09158 Development and regeneration
   04360 Axon guidance
    103910 (MYL12B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103910 (MYL12B)
   05131 Shigellosis
    103910 (MYL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    103910 (MYL12B)
   04147 Exosome [BR:hsa04147]
    103910 (MYL12B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     103910 (MYL12B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   103910 (MYL12B)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF2666 DUF3741 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 103910
NCBI-ProteinID: NP_001138416
OMIM: 609211
HGNC: 29827
Ensembl: ENSG00000118680
Vega: OTTHUMG00000131510
UniProt: O14950
LinkDB
Position
18p11.31
AA seq 172 aa
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaaaggcaaagaccaagaccaccaagaagcgccctcagcgtgcaacatcc
aatgtgtttgccatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatg
attgatcagaacagagatggcttcatcgacaaggaagatttgcatgatatgcttgcttct
ctagggaagaatcccactgatgcataccttgatgccatgatgaatgaggccccagggccc
atcaatttcaccatgttcctgaccatgtttggtgagaagttaaatggcacagatcctgaa
gatgtcatcagaaacgcctttgcttgctttgatgaagaagcaacaggcaccattcaggaa
gattacctaagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggat
gagctgtacagagaagcacctattgacaaaaaggggaatttcaattacatcgagttcaca
cgcatcctgaaacatggagccaaagacaaagatgactga

KEGG   Homo sapiens (human): 10398
Entry
10398             CDS       T01001                                 

Gene name
MYL9, LC20, MLC-2C, MLC2, MRLC1, MYRL2
Definition
(RefSeq) myosin light chain 9
  KO
K12755  myosin regulatory light chain 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa05131  Shigellosis
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01074  Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway
N01130  Salmonella SopB to RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10398 (MYL9)
   04022 cGMP-PKG signaling pathway
    10398 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10398 (MYL9)
   04530 Tight junction
    10398 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10398 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    10398 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    10398 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10398 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    10398 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10398 (MYL9)
   05131 Shigellosis
    10398 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10398 (MYL9)
   04147 Exosome [BR:hsa04147]
    10398 (MYL9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10398 (MYL9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   10398 (MYL9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 10398
NCBI-ProteinID: NP_006088
OMIM: 609905
HGNC: 15754
Ensembl: ENSG00000101335
Vega: OTTHUMG00000032387
Pharos: P24844(Tbio)
UniProt: P24844 A0A384NY64
LinkDB
Position
20q11.23
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagcgggccaaagccaagaccaccaagaagcggccacagcgggccacatcc
aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggctttcaacatg
attgaccagaaccgtgatggcttcattgacaaggaggacctgcacgacatgctggcctcg
ctggggaagaaccccacagacgaatacctggagggcatgatgagcgaggccccggggccc
atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacggaccccgag
gatgtgattcgcaacgcctttgcctgcttcgacgaggaagcctcaggtttcatccatgag
gaccacctccgggagctgctcaccaccatgggtgaccgcttcacagatgaggaagtggac
gagatgtaccgggaggcacccattgataagaaaggcaacttcaactacgtggagttcacc
cgcatcctcaaacatggcgccaaggataaagacgactag

KEGG   Homo sapiens (human): 10627
Entry
10627             CDS       T01001                                 

Gene name
MYL12A, HEL-S-24, MLC-2B, MLCB, MRCL3, MRLC3, MYL2B
Definition
(RefSeq) myosin light chain 12A
  KO
K12757  myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01074  Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway
N01130  Salmonella SopB to RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10627 (MYL12A)
   04530 Tight junction
    10627 (MYL12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10627 (MYL12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    10627 (MYL12A)
   04670 Leukocyte transendothelial migration
    10627 (MYL12A)
  09158 Development and regeneration
   04360 Axon guidance
    10627 (MYL12A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10627 (MYL12A)
   05131 Shigellosis
    10627 (MYL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10627 (MYL12A)
   04147 Exosome [BR:hsa04147]
    10627 (MYL12A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10627 (MYL12A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   10627 (MYL12A)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 DUF2666 SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 10627
NCBI-ProteinID: NP_001289976
HGNC: 16701
Ensembl: ENSG00000101608
Vega: OTTHUMG00000131509
Pharos: P19105(Tbio)
UniProt: P19105
LinkDB
Position
18p11.31
AA seq 171 aa
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED
YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 516 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaagaacaaagaccaagaccaagaagcgccctcagcgtgcaacatccaat
gtgtttgctatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatgatt
gatcagaacagagatggtttcatcgacaaggaagatttgcatgatatgcttgcttcattg
gggaagaatccaactgatgagtatctagatgccatgatgaatgaggctccaggccccatc
aatttcaccatgttcctcaccatgtttggtgagaagttaaatggcacagatcctgaagat
gtcatcagaaatgcctttgcttgctttgatgaagaagcaactggcaccatacaggaagat
tacttgagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggatgag
ctgtacagagaagcacctattgataaaaaggggaatttcaattacatcgagttcacacgc
atcctgaaacatggagccaaagacaaagatgactga

KEGG   Homo sapiens (human): 140465
Entry
140465            CDS       T01001                                 

Gene name
MYL6B, MLC1SA
Definition
(RefSeq) myosin light chain 6B
  KO
K12751  myosin light chain 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04530  Tight junction
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    140465 (MYL6B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    140465 (MYL6B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    140465 (MYL6B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    140465 (MYL6B)
   04147 Exosome [BR:hsa04147]
    140465 (MYL6B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     140465 (MYL6B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   140465 (MYL6B)
  Exosomal proteins of bladder cancer cells
   140465 (MYL6B)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_9
Other DBs
NCBI-GeneID: 140465
NCBI-ProteinID: NP_001186558
OMIM: 609930
HGNC: 29823
Ensembl: ENSG00000196465
Vega: OTTHUMG00000170199
Pharos: P14649(Tdark)
UniProt: P14649 A0A024RB31
LinkDB
Structure
PDB: 
1OE9 1W7I 1W7J

Position
12q13.2
AA seq 208 aa
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIE
FNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSR
RVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEE
EVETVLAGHEDSNGCINYEAFLKHILSV
NT seq 627 nt   +upstreamnt  +downstreamnt
atgcctcccaagaaggatgttcccgtgaagaaaccagcagggccctccatctccaaacct
gctgctaagccagcagcagcaggggctcctccagccaagaccaaagctgagccagctgtc
ccccaggcccctcagaaaacccaggagcctccagtcgatctctccaaagtggtgatcgag
tttaacaaggaccagctggaggagttcaaggaggccttcgagctgtttgaccgagtgggg
gatggcaagatcctgtacagccagtgtggggacgtgatgagggccctgggccagaacccc
accaacgccgaggtgctcaaggtcctggggaaccccaagagtgatgagctgaagtcgcgg
cgtgtggactttgagactttcctgcccatgctccaggcagtggccaagaaccgaggccaa
ggcacatatgaggactacttggaggggtttcgtgtgtttgacaaggaggggaacggcaaa
gtcatgggagcagagctcagacatgttctcaccacccttggagagaagatgactgaggag
gaggtggagaccgttctggcaggacacgaggacagcaacggctgcatcaactacgaggcc
ttcttgaaacacatcctaagcgtctga

KEGG   Homo sapiens (human): 4627
Entry
4627              CDS       T01001                                 

Gene name
MYH9, BDPLT6, DFNA17, EPSTS, FTNS, MATINS, MHA, NMHC-II-A, NMMHC-IIA, NMMHCA
Definition
(RefSeq) myosin heavy chain 9
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04530  Tight junction
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
Disease
H00233  MYH9-related disease
H00578  Epstein syndrome
H00604  Deafness, autosomal dominant
H01740  Macrothrombocytopenia
H02051  May-Hegglin anomaly
H02052  Sebastian syndrome
H02053  Fechtner syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4627 (MYH9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4627 (MYH9)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4627 (MYH9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    4627 (MYH9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4627 (MYH9)
   04147 Exosome [BR:hsa04147]
    4627 (MYH9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4627 (MYH9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4627 (MYH9)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ Crescentin CC2-LZ ADIP AAA_22
Other DBs
NCBI-GeneID: 4627
NCBI-ProteinID: NP_002464
OMIM: 160775
HGNC: 7579
Ensembl: ENSG00000100345
Vega: OTTHUMG00000030429
Pharos: P35579(Tbio)
UniProt: P35579 A0A024R1N1
LinkDB
Structure
PDB: 
4CFQ 4CFR 3ZWH 2LNK

Position
22q12.3
AA seq 1960 aa
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL
ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQ
YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
NT seq 5883 nt   +upstreamnt  +downstreamnt
atggcacagcaagctgccgataagtatctctatgtggataaaaacttcatcaacaatccg
ctggcccaggccgactgggctgccaagaagctggtatgggtgccttccgacaagagtggc
tttgagccagccagcctcaaggaggaggtgggcgaagaggccatcgtggagctggtggag
aatgggaagaaggtgaaggtgaacaaggatgacatccagaagatgaacccgcccaagttc
tccaaggtggaggacatggcagagctcacgtgcctcaacgaagcctcggtgctgcacaac
ctcaaggagcgttactactcagggctcatctacacctattcaggcctgttctgtgtggtc
atcaatccttacaagaacctgcccatctactctgaagagattgtggaaatgtacaagggc
aagaagaggcacgagatgccccctcacatctatgccatcacagacaccgcctacaggagt
atgatgcaagaccgagaagatcaatccatcttgtgcactggtgaatctggagctggcaag
acggagaacaccaagaaggtcatccagtatctggcgtacgtggcgtcctcgcacaagagc
aagaaggaccagggcgagctggagcggcagctgctgcaggccaaccccatcctggaggcc
ttcgggaacgccaagaccgtgaagaatgacaactcctcccgcttcggcaaattcattcgc
atcaactttgatgtcaatggctacattgttggagccaacattgagacttatcttttggag
aaatctcgtgctatccgccaagccaaggaagaacggaccttccacatcttctattatctc
ctgtctggggctggagagcacctgaagaccgatctcctgttggagccgtacaacaaatac
cgcttcctgtccaatggacacgtcaccatccccgggcagcaggacaaggacatgttccag
gagaccatggaggccatgaggattatgggcatcccagaagaggagcaaatgggcctgctg
cgggtcatctcaggggttcttcagctcggcaacatcgtcttcaagaaggagcggaacact
gaccaggcgtccatgcccgacaacacagctgcccaaaaggtgtcccatctcttgggtatc
aatgtgaccgatttcaccagaggaatcctcaccccgcgcatcaaggtgggacgggattac
gtccagaaggcgcagactaaagagcaggctgactttgccatcgaggccttggccaaggcg
acctatgagcggatgttccgctggctggtgctgcgcatcaacaaggctctggacaagacc
aagaggcagggcgcctccttcatcgggatcctggacattgccggcttcgagatctttgat
ctgaactcgtttgagcagctgtgcatcaattacaccaatgagaagctgcagcagctcttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgcgagggcatcgagtggaac
ttcatcgactttggcctcgacctgcagccctgcatcgacctcattgagaagccagcaggc
cccccgggcattctggccctgctggacgaggagtgctggttccccaaagccaccgacaag
agcttcgtggagaaggtgatgcaggagcagggcacccaccccaagttccagaagcccaag
cagctgaaggacaaagctgatttctgcattatccactatgccggcaaggtggattacaaa
gctgacgagtggctgatgaagaacatggatcccctgaatgacaacatcgccacactgctc
caccagtcctctgacaagtttgtctcggagctgtggaaggatgtggaccgcatcatcggc
ctggaccaggtggccggcatgtcggagaccgcactgcccggggccttcaagacgcggaag
ggcatgttccgcactgtggggcagctttacaaggagcagctggccaagctgatggctacg
ctgaggaacacgaaccccaactttgtccgctgcatcatccccaaccacgagaagaaggcc
ggcaagctggacccgcatctcgtgctggaccagctgcgctgcaacggtgttctcgagggc
atccgtatctgccgccagggcttccccaacagggtggtcttccaggagtttcggcagaga
tatgagatcctgactccaaactccattcccaagggtttcatggacgggaagcaggcgtgc
gtgctcatgataaaagccctggagctcgacagcaatctgtaccgcattggccagagcaaa
gtcttcttccgtgccggtgtgctggcccacctggaggaggagcgagacctgaagatcacc
gacgtcatcatagggttccaggcctgctgcaggggctacctggccaggaaagcatttgcc
aagcggcagcagcagcttaccgccatgaaggtcctccagcggaactgcgctgcctacctg
aagctgcggaactggcagtggtggcggctcttcaccaaggtcaagccgctgctgcaggtg
agccggcaggaggaggagatgatggccaaggaggaggagctggtgaaggtcagagagaag
cagctggctgcggagaacaggctcacggagatggagacgctgcagtctcagctcatggca
gagaaattgcagctgcaggagcagctccaggcagaaaccgagctgtgtgccgaggctgag
gagctccgggcccgcctgaccgccaagaagcaggaattagaagagatctgccatgaccta
gaggccagggtggaggaggaggaggagcgctgccagcacctgcaggcggagaagaagaag
atgcagcagaacatccaggagcttgaggagcagctggaggaggaggagagcgcccggcag
aagctgcagctggagaaggtgaccaccgaggcgaagctgaaaaagctggaggaggagcag
atcatcctggaggaccagaactgcaagctggccaaggaaaagaaactgctggaagacaga
atagctgagttcaccaccaacctcacagaagaggaggagaaatctaagagcctcgccaag
ctcaagaacaagcatgaggcaatgatcactgacttggaagagcgcctccgcagggaggag
aagcagcgacaggagctggagaagacccgccggaagctggagggagactccacagacctc
agcgaccagatcgccgagctccaggcccagatcgcggagctcaagatgcagctggccaag
aaagaggaggagctccaggccgccctggccagagtggaagaggaagctgcccagaagaac
atggccctcaagaagatccgggagctggaatctcagatctctgaactccaggaagacctg
gagtctgagcgtgcttccaggaataaagctgagaagcagaaacgggaccttggggaagag
ctagaggctctgaaaacagagttggaggacacgctggattccacagctgcccagcaggag
ctcaggtcaaaacgtgagcaggaggtgaacatcctgaagaagaccctggaggaggaggcc
aagacccacgaggcccagatccaggagatgaggcagaagcactcacaggccgtggaggag
ctggcggagcagctggagcagacgaagcgggtgaaagcaaacctcgagaaggcaaagcag
actctggagaacgagcggggggagctggccaacgaggtgaaggtgctgctgcagggcaaa
ggggactcggagcacaagcgcaagaaagtggaggcgcagctgcaggagctgcaggtcaag
ttcaacgagggagagcgcgtgcgcacagagctggccgacaaggtcaccaagctgcaggtg
gagctggacaacgtgaccgggcttctcagccagtccgacagcaagtccagcaagctcacc
aaggacttctccgcgctggagtcccagctgcaggacactcaggagctgctgcaggaggag
aaccggcagaagctgagcctgagcaccaagctcaagcaggtggaggacgagaagaattcc
ttccgggagcagctggaggaggaggaggaggccaagcacaacctggagaagcagatcgcc
accctccatgcccaggtggccgacatgaaaaagaagatggaggacagtgtggggtgcctg
gaaactgctgaggaggtgaagaggaagctccagaaggacctggagggcctgagccagcgg
cacgaggagaaggtggccgcctacgacaagctggagaagaccaagacgcggctgcagcag
gagctggacgacctgctggtggacctggaccaccagcgccagagcgcgtgcaacctggag
aagaagcagaagaagtttgaccagctcctggcggaggagaagaccatctctgccaagtat
gcagaggagcgcgaccgggctgaggcggaggcccgagagaaggagaccaaggctctgtcg
ctggcccgggccctggaggaagccatggagcagaaggcggagctggagcggctcaacaag
cagttccgcacggagatggaggaccttatgagctccaaggatgatgtgggcaagagtgtc
cacgagctggagaagtccaagcgggccctagagcagcaggtggaggagatgaagacgcag
ctggaagagctggaggacgagctgcaggccaccgaagatgccaagctgcggttggaggtc
aacctgcaggccatgaaggcccagttcgagcgggacctgcagggccgggacgagcagagc
gaggagaagaagaagcagctggtcagacaggtgcgggagatggaggcagagctggaggac
gagaggaagcagcgctcgatggcagtggccgcccggaagaagctggagatggacctgaag
gacctggaggcgcacatcgactcggccaacaagaaccgggacgaagccatcaaacagctg
cggaagctgcaggcccagatgaaggactgcatgcgcgagctggatgacacccgcgcctct
cgtgaggagatcctggcccaggccaaagagaacgagaagaagctgaagagcatggaggcc
gagatgatccagttgcaggaggaactggcagccgcggagcgtgccaagcgccaggcccag
caggagcgggatgagctggctgacgagatcgccaacagcagcggcaaaggagccctggcg
ttagaggagaagcggcgtctggaggcccgcatcgcccagctggaggaggagctggaggag
gagcagggcaacacggagctgatcaacgaccggctgaagaaggccaacctgcagatcgac
cagatcaacaccgacctgaacctggagcgcagccacgcccagaagaacgagaatgctcgg
cagcagctggaacgccagaacaaggagcttaaggtcaagctgcaggagatggagggcact
gtcaagtccaagtacaaggcctccatcaccgccctcgaggccaagattgcacagctggag
gagcagctggacaacgagaccaaggagcgccaggcagcctgcaaacaggtgcgtcggacc
gagaagaagctgaaggatgtgctgctgcaggtggatgacgagcggaggaacgccgagcag
tacaaggaccaggccgacaaggcatctacccgcctgaagcagctcaagcggcagctggag
gaggccgaagaggaggcccagcgggccaacgcctcccgccggaaactgcagcgcgagctg
gaggacgccactgagacggccgatgccatgaaccgcgaagtcagctccctaaagaacaag
ctcaggcgcggggacctgccgtttgtcgtgccccgccgaatggcccggaaaggcgccggg
gatggctccgacgaagaggtagatggcaaagcggatggggctgaggccaaacctgccgaa
taa

KEGG   Homo sapiens (human): 4628
Entry
4628              CDS       T01001                                 

Gene name
MYH10, NMMHC-IIB, NMMHCB
Definition
(RefSeq) myosin heavy chain 10
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04530  Tight junction
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4628 (MYH10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4628 (MYH10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4628 (MYH10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    4628 (MYH10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4628 (MYH10)
   04147 Exosome [BR:hsa04147]
    4628 (MYH10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4628 (MYH10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4628 (MYH10)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ ADIP CC2-LZ AAA_22 Crescentin
Other DBs
NCBI-GeneID: 4628
NCBI-ProteinID: NP_005955
OMIM: 160776
HGNC: 7568
Ensembl: ENSG00000133026
Vega: OTTHUMG00000108195
Pharos: P35580(Tbio)
UniProt: P35580
LinkDB
Position
17p13.1
AA seq 1976 aa
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECW
FPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEE
ERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
ELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLD
EEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEE
KAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDE
LKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQ
KRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQR
HATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ
VQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQDT
QELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKV
DDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQR
QVASNLEKKQKKFDQLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKE
EFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATED
AKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKK
KMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK
KLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQ
LEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAK
LQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVED
ERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSRE
VSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE
NT seq 5931 nt   +upstreamnt  +downstreamnt
atggcgcagagaactggactcgaggatccagagaggtatctctttgtggacagggctgtc
atctacaaccctgccactcaagctgattggacagctaaaaagctagtgtggattccatca
gaacgccatggttttgaggcagctagtatcaaagaagaacggggagatgaagttatggtg
gagttggcagagaatggaaagaaagcaatggtcaacaaagatgatattcagaagatgaac
ccacctaagttttccaaggtggaggatatggcagaattgacatgcttgaatgaagcttcc
gttttacataatctgaaggatcgctactattcaggactaatctatacttattctggactc
ttctgtgtagttataaacccttacaagaatcttccaatttactctgagaatattattgaa
atgtacagagggaagaagcgtcatgagatgcctccacacatctatgctatatctgaatct
gcttacagatgcatgcttcaagatcgtgaggaccagtcaattctttgcacgggtgagtca
ggtgctgggaagacagaaaatacaaagaaagttattcagtaccttgcccatgttgcttct
tcacataaaggaagaaaggaccataatattcctggggaacttgaacggcagcttttgcaa
gcaaatccaattctggaatcatttggaaatgcgaagactgtgaaaaatgataactcatct
cgttttggcaaatttattcggatcaactttgatgtaactggctatatcgttggggccaac
attgaaacataccttctggaaaagtctcgtgctgttcgtcaagcaaaagatgaacgtact
tttcatatcttttaccagttgttatctggagcaggagaacacctaaagtctgatttgctt
cttgaaggatttaataactacaggtttctctccaatggctatattcctattccgggacag
caagacaaagataatttccaggagaccatggaagcaatgcacataatgggcttctcccat
gaagagattctgtcaatgcttaaagtagtatcttcagtgctacagtttggaaatatttct
ttcaaaaaggagagaaatactgatcaagcttccatgccagaaaatacagttgcgcagaag
ctctgccatcttcttgggatgaatgtgatggagtttactcgggccatcctgactccccgg
atcaaggtcggccgagactatgtgcaaaaagcccagaccaaagaacaggcagattttgca
gtagaagcattggcaaaagctacctatgagcggctctttcgctggctcgttcatcgcatc
aataaagctctggataggaccaaacgtcagggagcatctttcattggaatcctggatatt
gctggatttgaaatttttgagctgaactcctttgaacaactttgcatcaactacaccaat
gagaagctgcagcagctgttcaaccacaccatgtttatcctagaacaagaggaataccag
cgcgaaggcatcgagtggaacttcatcgatttcgggctggatctgcagccatgcatcgac
ctaatagagagacctgcgaaccctcctggtgtactggcccttttggatgaagaatgctgg
ttccctaaagccacagataaaacctttgttgaaaaactggttcaagagcaaggttcccac
tccaagtttcagaaacctcgacaattaaaagacaaagctgatttttgcattatacattat
gcagggaaggtggactataaggcagatgagtggctgatgaagaatatggaccccctgaat
gacaacgtggccacccttttgcaccagtcatcagacagatttgtggcagagctttggaaa
gatgtggaccgtatcgtgggtctggatcaagtcactggtatgactgagacagcttttggc
tccgcatataaaaccaagaagggcatgtttcgtaccgttgggcaactctacaaagaatct
ctcaccaagctgatggcaactctccgaaacaccaaccctaactttgttcgttgtatcatt
ccaaatcacgagaagagggctggaaaattggatccacacctagtcctagatcagcttcgc
tgtaacggtgtcctggaagggatccgaatctgtcgccagggcttccctaaccgaatagtt
ttccaggaattcagacagagatatgagatcctaactccaaatgctattcctaaaggtttt
atggatggtaaacaggcctgtgaacgaatgatccgggctttagaattggacccaaacttg
tacagaattggacagagcaagatatttttcagagctggagttctggcacacttagaggaa
gaaagagatttaaaaatcaccgatatcattatcttcttccaggccgtttgcagaggttac
ctggccagaaaggcctttgccaagaagcagcagcaactaagtgccttaaaggtcttgcag
cggaactgtgccgcgtacctgaaattacggcactggcagtggtggcgagtcttcacaaag
gtgaagccgcttctacaagtgactcgccaggaggaagaacttcaggccaaagatgaagag
ctgttgaaggtgaaggagaagcagacgaaggtggaaggagagctggaggagatggagcgg
aagcaccagcagcttttagaagagaagaatatccttgcagaacaactacaagcagagact
gagctctttgctgaagcagaagagatgagggcaagacttgctgctaaaaagcaggaatta
gaagagattctacatgacttggagtctagggttgaagaagaagaagaaagaaaccaaatc
ctccaaaatgaaaagaaaaaaatgcaagcacatattcaggacctggaagaacagctagac
gaggaggaaggggctcggcaaaagctgcagctggaaaaggtgacagcagaggccaagatc
aagaagatggaagaggagattctgcttctcgaggaccaaaattccaagttcatcaaagaa
aagaaactcatggaagatcgcattgctgagtgttcctctcagctggctgaagaggaagaa
aaggcgaaaaacttggccaaaatcaggaataagcaagaagtgatgatctcagatttagaa
gaacgcttaaagaaggaagaaaagactcgtcaggaactggaaaaggccaaaagaaaactc
gacggggagacgaccgacctgcaggaccagatcgcagagctgcaggcgcagattgatgag
ctcaagctgcagctggccaagaaggaggaggagctgcagggcgcactggccagaggtgat
gatgaaacactccataagaacaatgcccttaaagttgtgcgagagctacaagcccaaatt
gctgaacttcaggaagactttgaatccgagaaggcttcacggaacaaggccgaaaagcag
aaaagggacttgagtgaggaactggaagctctgaaaacagagctggaggacacgctggac
accacggcagcccagcaggaactacgtacaaaacgtgaacaagaagtggcagagctgaag
aaagctcttgaggaggaaactaagaaccatgaagctcaaatccaggacatgagacaaaga
cacgcaacagccctggaggagctctcagagcagctggaacaggccaagcggttcaaagca
aatctagagaagaacaagcagggcctggagacagataacaaggagctggcgtgtgaggtg
aaggtcctgcagcaggtcaaggctgagtctgagcacaagaggaagaagctcgacgcgcag
gtccaggagctccatgccaaggtctctgaaggcgacaggctcagggtggagctggcggag
aaagcaagtaagctgcagaatgagctagataatgtctccacccttctggaagaagcagag
aagaagggtattaaatttgctaaggatgcagctagtcttgagtctcaactacaggataca
caggagcttcttcaggaggagacacgccagaaactaaacctgagcagtcggatccggcag
ctggaagaggagaagaacagtcttcaggagcagcaggaggaggaggaggaggccaggaag
aacctggagaagcaagtgctggccctgcagtcccagttggctgataccaagaagaaagta
gatgacgacctgggaacaattgaaagtctggaagaagccaagaagaagcttctgaaggac
gcggaggccctgagccagcgcctggaggagaaggcactggcgtatgacaaactggagaag
accaagaaccgcctgcagcaggagctggacgacctcacggtggacctggaccaccagcgc
caggtcgcctccaacttggagaagaagcagaagaagtttgaccagctgttagcagaagag
aagagcatctctgctcgctatgccgaagagcgggaccgggccgaagccgaggccagagag
aaagaaaccaaagccctgtcactggcccgggccctcgaggaagccctggaggccaaggag
gagtttgagaggcagaacaagcagctccgagcagacatggaagacctcatgagctccaaa
gatgatgtgggaaaaaacgttcacgaacttgaaaaatccaaacgggccctagagcagcag
gtggaggaaatgaggacccagctggaggagctggaagacgaactccaggccacggaagat
gccaagcttcgtctggaggtcaacatgcaggccatgaaggcgcagttcgagagagacctg
caaaccagggatgagcagaatgaagagaagaagcggctgctgatcaaacaggtgcgggag
ctcgaggcggagctggaggatgagaggaaacagcgggcgcttgctgtagcttcaaagaaa
aagatggagatagacctgaaggacctcgaagcccaaatcgaggctgcgaacaaagctcgg
gatgaggtgattaagcagctccgcaagctccaggctcagatgaaggattaccaacgtgaa
ttagaagaagctcgtgcatccagagatgagatttttgctcaatccaaagagagtgaaaag
aaattgaagagtctggaagcagaaatccttcaattgcaggaggaacttgcctcatctgag
cgagcccgccgacacgccgagcaggagagagatgagctggcggacgagatcaccaacagc
gcctctggcaagtccgcgctgctggatgagaagcggcgtctggaagctcggatcgcacag
ctggaggaggagctggaagaggagcagagcaacatggagctgctcaacgaccgcttccgc
aagaccactctacaggtggacacactgaacgccgagctagcagccgagcgcagcgccgcc
cagaagagtgacaatgcacgccagcaactggagcggcagaacaaggagctgaaggccaag
ctgcaggaactcgagggtgctgtcaagtctaagttcaaggccaccatctcagccctggag
gccaagattgggcagctggaggagcagcttgagcaggaagccaaggaacgagcagccgcc
aacaaattagtccgtcgcactgagaagaagctgaaagaaatcttcatgcaggttgaggat
gagcgtcgacacgcggaccagtataaagagcagatggagaaggccaacgctcggatgaag
cagcttaaacgccagctggaggaagcagaagaagaagcgacgcgtgccaacgcatctcgg
cgtaaactccagcgggaactggatgatgccaccgaggccaacgagggcctgagccgcgag
gtcagcaccctgaagaaccggctgaggcggggtggccccatcagcttctcttccagccga
tctggccggcgccagctgcaccttgaaggagcttccctggagctctccgacgatgacaca
gaaagtaagaccagtgatgtcaacgagacgcagccaccccagtcagagtaa

KEGG   Homo sapiens (human): 4629
Entry
4629              CDS       T01001                                 

Gene name
MYH11, AAT4, FAA4, SMHC, SMMHC
Definition
(RefSeq) myosin heavy chain 11
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04530  Tight junction
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
Disease
H00801  Familial thoracic aortic aneurysm and dissection
H01630  Patent ductus arteriosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4629 (MYH11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4629 (MYH11)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4629 (MYH11)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    4629 (MYH11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4629 (MYH11)
   04147 Exosome [BR:hsa04147]
    4629 (MYH11)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4629 (MYH11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4629 (MYH11)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N Crescentin CC2-LZ IQ ATG16 ADIP DUF4201 AAA_22
Other DBs
NCBI-GeneID: 4629
NCBI-ProteinID: NP_002465
OMIM: 160745
HGNC: 7569
Ensembl: ENSG00000133392
Vega: OTTHUMG00000129935
Pharos: P35749(Tbio)
UniProt: P35749 A0A024QZJ4
LinkDB
Position
16p13.11
AA seq 1972 aa
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVV
ELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGL
FCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLL
LEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIV
FKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFA
VEALAKATYERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECW
FPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLN
DNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQ
LGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEE
ERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTK
VKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAET
ELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLE
EEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEE
KAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAE
LKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQ
KRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQK
HAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQ
VQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDT
QELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKL
QDFASTVEALEEGKKRFQKEIENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQR
QLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKE
ELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATED
AKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKK
KLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEK
KAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQ
LEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSK
LHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVED
ERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGRE
VNALKSKLRRGNETSFVPSRRSGGRRVIENADGSEEETDTRDADFNGTKASE
NT seq 5919 nt   +upstreamnt  +downstreamnt
atggcgcagaagggccaactcagtgacgatgagaagttcctctttgtggacaaaaacttc
atcaacagcccagtggcccaggctgactgggccgccaagagactcgtctgggtcccctcg
gagaagcagggcttcgaggcagccagcattaaggaggagaagggggatgaggtggttgtg
gagctggtggagaatggcaagaaggtcacggttgggaaagatgacatccagaagatgaac
ccacccaagttctccaaggtggaggacatggcggagctgacgtgcctcaacgaagcctcc
gtgctacacaacctgagggagcggtacttctcagggctaatatatacgtactctggcctc
ttctgcgtggtggtcaacccctataaacacctgcccatctactcggagaagatcgtcgac
atgtacaagggcaagaagaggcacgagatgccgcctcacatctacgccatcgcagacacg
gcctaccggagcatgcttcaagatcgggaggaccagtccattctatgcacaggcgagtct
ggagccgggaaaaccgaaaacaccaagaaggtcattcagtacctggccgtggtggcctcc
tcccacaagggcaagaaagacacaagtatcacgggagagctggaaaagcagcttctacaa
gcaaacccgattctggaggctttcggcaacgccaaaacagtgaagaacgacaactcctca
cgattcggcaaattcatccgcatcaacttcgacgtcacgggttacatcgtgggagccaac
attgagacctatctgctagaaaaatcacgggcaattcgccaagccagagacgagaggaca
ttccacatcttttactacatgattgctggagccaaggagaagatgagaagtgacttgctt
ttggagggcttcaacaactacaccttcctctccaatggctttgtgcccatcccagcagcc
caggatgatgagatgttccaggaaaccgtggaggccatggcaatcatgggtttcagcgag
gaggagcagctatccatattgaaggtggtatcatcggtcctgcagcttggaaatatcgtc
ttcaagaaggaaagaaacacagaccaggcgtccatgccagataacacagctgctcagaaa
gtttgccacctcatgggaattaatgtgacagatttcaccagatccatcctcactcctcgt
atcaaggttgggcgagatgtggtacagaaagctcagacaaaagaacaggctgactttgct
gtagaggctttggccaaggcaacatatgagcgccttttccgctggatactcacccgcgtg
aacaaagccctggacaagacccatcggcaaggggcttccttcctggggatcctggatata
gctggatttgagatctttgaggtgaactccttcgagcagctgtgcatcaactacaccaac
gagaagctgcagcagctcttcaaccacaccatgttcatcctggagcaggaggagtaccag
cgcgagggcatcgagtggaacttcatcgactttgggctggacctacagccctgcatcgag
ctcatcgagcgaccgaacaaccctccaggtgtgctggccctgctggacgaggaatgctgg
ttccccaaagccacggacaagtctttcgtggagaagctgtgcacggagcagggcagccac
cccaagttccagaagcccaagcagctcaaggacaagactgagttctccatcatccattat
gctgggaaggtggactataatgcgagtgcctggctgaccaagaatatggacccgctgaat
gacaacgtgacttccctgctcaatgcctcctccgacaagtttgtggccgacctgtggaag
gacgtggaccgcatcgtgggcctggaccagatggccaagatgacggagagctcgctgccc
agcgcctccaagaccaagaagggcatgttccgcacagtggggcagctgtacaaggagcag
ctgggcaagctgatgaccacgctacgcaacaccacgcccaacttcgtgcgctgcatcatc
cccaaccacgagaagaggtccggcaagctggatgcgttcctggtgctggagcagctgcgg
tgcaatggggtgctggaaggcattcgcatctgccggcagggcttccccaaccggatcgtc
ttccaggagttccgccaacgctacgagatcctggcggcgaatgccatccccaaaggcttc
atggacgggaagcaggcctgcattctcatgatcaaagccctggaacttgaccccaactta
tacaggatagggcagagcaaaatcttcttccgaactggcgtcctggcccacctagaggag
gagcgagatttgaagatcaccgatgtcatcatggccttccaggcgatgtgtcgtggctac
ttggccagaaaggcttttgccaagaggcagcagcagctgaccgccatgaaggtgattcag
aggaactgcgccgcctacctcaagctgcggaactggcagtggtggaggcttttcaccaaa
gtgaagccactgctgcaggtgacacggcaggaggaggagatgcaggccaaggaggatgaa
ctgcagaagaccaaggagcggcagcagaaggcagagaatgagcttaaggagctggaacag
aagcactcgcagctgaccgaggagaagaacctgctacaggaacagctgcaggcagagaca
gagctgtatgcagaggctgaggagatgcgggtgcggctggcggccaagaagcaggagctg
gaggagatactgcatgagatggaggcccgcctggaggaggaggaagacaggggccagcag
ctacaggctgaaaggaagaagatggcccagcagatgctggaccttgaagaacagctggag
gaggaggaagctgccaggcagaagctgcaacttgagaaggtcacggctgaggccaagatc
aagaaactggaggatgagatcctggtcatggatgatcagaacaataaactatcaaaagaa
cgaaaactccttgaggagaggattagtgacttaacgacaaatcttgcagaagaggaagaa
aaggccaagaatcttaccaagctgaaaaacaagcatgaatctatgatttcagaactggaa
gtgcggctaaagaaggaagagaagagccgacaggagctggagaagctgaaacggaagctg
gagggtgatgccagcgacttccacgagcagatcgctgacctccaggcgcagatcgcagag
ctcaagatgcagctggccaagaaggaggaggagctgcaggcggccctggccaggcttgac
gatgaaatcgctcagaagaacaatgccctgaagaagatccgggagctggagggccacatc
tcagacctccaggaggacctggactcagagcgggccgccaggaacaaggctgaaaagcag
aagcgagacctcggcgaggagctggaggccctaaagacagagctggaagacacactggac
agcacagccactcagcaggagctcagggccaagagggagcaggaggtgacggtgctgaag
aaggccctggatgaagagacgcggtcccatgaggctcaggtccaggagatgaggcagaaa
cacgcacaggcggtggaggagctcacagagcagcttgagcagttcaagagggccaaggcg
aacctagacaagaataagcagacgctggagaaagagaacgcagacctggccggggagctg
cgggtcctgggccaggccaagcaggaggtggaacataagaagaagaagctggaggcgcag
gtgcaggagctgcagtccaagtgcagcgatggggagcgggcccgggcggagctcaatgac
aaagtccacaagctgcagaatgaagttgagagcgtcacagggatgcttaacgaggccgag
gggaaggccattaagctggccaaggacgtggcgtccctcagttcccagctccaggacacc
caggagctgcttcaagaagaaacccggcagaagctcaacgtgtctacgaagctgcgccag
ctggaggaggagcggaacagcctgcaagaccagctggacgaggagatggaggccaagcag
aacctggagcgccacatctccactctcaacatccagctctccgactcgaagaagaagctg
caggactttgccagcaccgtggaagctctggaagaggggaagaagaggttccagaaggag
atcgagaacctcacccagcagtacgaggagaaggcggccgcttatgataaactggaaaag
accaagaacaggcttcagcaggagctggacgacctggttgttgatttggacaaccagcgg
caactcgtgtccaacctggaaaagaagcagaggaaatttgatcagttgttagccgaggag
aaaaacatctcttccaaatacgcggatgagagggacagagctgaggcagaagccagggag
aaggaaaccaaggccctgtccctggctcgggcccttgaagaggccttggaagccaaagag
gaactcgagcggaccaacaaaatgctcaaagccgaaatggaagacctggtcagctccaag
gatgacgtgggcaagaacgtccatgagctggagaagtccaagcgggccctggagacccag
atggaggagatgaagacgcagctggaagagctggaggacgagctgcaagccacggaggac
gccaaactgcggctggaagtcaacatgcaggcgctcaagggccagttcgaaagggatctc
caagcccgggacgagcagaatgaggagaagaggaggcaactgcagagacagcttcacgag
tatgagacggaactggaagacgagcgaaagcaacgtgccctggcagctgcagcaaagaag
aagctggaaggggacctgaaagacctggagcttcaggccgactctgccatcaaggggagg
gaggaagccatcaagcagctacgcaaactgcaggctcagatgaaggactttcaaagagag
ctggaagatgcccgtgcctccagagatgagatctttgccacagccaaagagaatgagaag
aaagccaagagcttggaagcagacctcatgcagctacaagaggacctcgccgccgctgag
agggctcgcaaacaagcggacctcgagaaggaggaactggcagaggagctggccagtagc
ctgtcgggaaggaacgcactccaggacgagaagcgccgcctggaggcccggatcgcccag
ctggaggaggagctggaggaggagcagggcaacatggaggccatgagcgaccgggtccgc
aaagccacacagcaggccgagcagctcagcaacgagctggccacagagcgcagcacggcc
cagaagaatgagagtgcccggcagcagctcgagcggcagaacaaggagctccggagcaag
ctccacgagatggagggggccgtcaagtccaagttcaagtccaccatcgcggcgctggag
gccaagattgcacagctggaggagcaggtcgagcaggaggccagagagaaacaggcggcc
accaagtcgctgaagcagaaagacaagaagctgaaggaaatcttgctgcaggtggaggac
gagcgcaagatggccgagcagtacaaggagcaggcagagaaaggcaatgccagggtcaag
cagctcaagaggcagctggaggaggcagaggaggagtcccagcgcatcaacgccaaccgc
aggaagctgcagcgggagctggatgaggccacggagagcaacgaggccatgggccgcgag
gtgaacgcactcaagagcaagctcaggcgaggaaacgagacctctttcgttccttctaga
aggtctggaggacgtagagttattgaaaatgcagatggttctgaggaggaaacggacact
cgagacgcagacttcaatggaaccaaggccagtgaataa

KEGG   Homo sapiens (human): 4637
Entry
4637              CDS       T01001                                 

Gene name
MYL6, ESMLC, LC17, LC17-GI, LC17-NM, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM, MLC3SM
Definition
(RefSeq) myosin light chain 6
  KO
K12751  myosin light chain 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04530  Tight junction
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4637 (MYL6)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4637 (MYL6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4637 (MYL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4637 (MYL6)
   04147 Exosome [BR:hsa04147]
    4637 (MYL6)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4637 (MYL6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4637 (MYL6)
  Exosomal proteins of bladder cancer cells
   4637 (MYL6)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_9 EF-hand_5
Other DBs
NCBI-GeneID: 4637
NCBI-ProteinID: NP_066299
OMIM: 609931
HGNC: 7587
Ensembl: ENSG00000092841
Vega: OTTHUMG00000170200
Pharos: P60660(Tbio)
UniProt: P60660
LinkDB
Position
12q13.2
AA seq 151 aa
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEAFVRHILSG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtgtgacttcaccgaagaccagaccgcagagttcaaggaggccttccagctgtttgac
cgaacaggtgatggcaagatcctgtacagccagtgtggggatgtgatgagggccctgggc
cagaaccctaccaacgccgaggtgctcaaggtcctggggaaccccaagagtgatgagatg
aatgtgaaggtgctggactttgagcactttctgcccatgctgcagacagtggccaagaac
aaggaccagggcacctatgaggattatgtcgaaggacttcgggtgtttgacaaggaagga
aatggcaccgtcatgggtgctgaaatccggcatgttcttgtcacactgggtgagaagatg
acagaggaagaagtagagatgctggtggcagggcatgaggacagcaatggttgtatcaac
tatgaagcgtttgtgaggcatatcctgtcggggtga

KEGG   Homo sapiens (human): 79784
Entry
79784             CDS       T01001                                 

Gene name
MYH14, DFNA4, DFNA4A, FP17425, MHC16, MYH17, NMHC_II-C, NMHC-II-C, PNMHH, myosin
Definition
(RefSeq) myosin heavy chain 14
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04530  Tight junction
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    79784 (MYH14)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79784 (MYH14)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    79784 (MYH14)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    79784 (MYH14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    79784 (MYH14)
   04147 Exosome [BR:hsa04147]
    79784 (MYH14)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     79784 (MYH14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   79784 (MYH14)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head ADIP Myosin_N IQ AAA_22
Other DBs
NCBI-GeneID: 79784
NCBI-ProteinID: NP_079005
OMIM: 608568
HGNC: 23212
Ensembl: ENSG00000105357
Vega: OTTHUMG00000183034
Pharos: Q7Z406(Tbio)
UniProt: Q7Z406
LinkDB
Position
19q13.33
AA seq 1995 aa
MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPS
ELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEAS
VLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEG
AYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDECS
FHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHE
EIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALLTPRI
KVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIA
GFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDL
IERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYA
GKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGG
RPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNG
VLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQALELDPNLYRV
GQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQKRQQQQSALRVMQRNC
AAYLKLRHWQWWRLFTKVKPLLQVTRQDEVLQARAQELQKVQELQQQSAREVGELQGRVA
QLEEERARLAEQLRAEAELCAEAEETRGRLAARKQELELVVSELEARVGEEEECSRQMQT
EKKRLQQHIQELEAHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERKL
LEDRLAEFSSQAAEEEEKVKSLNKLRLKYEATIADMEDRLRKEEKGRQELEKLKRRLDGE
SSELQEQMVEQQQRAEELRAQLGRKEEELQAALARAEDEGGARAQLLKSLREAQAALAEA
QEDLESERVARTKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKREQEVTELKKTL
EEETRIHEAAVQELRQRHGQALGELAEQLEQARRGKGAWEKTRLALEAEVSELRAELSSL
QTARQEGEQRRRRLELQLQEVQGRAGDGERARAEAAEKLQRAQAELENVSGALNEAESKT
IRLSKELSSTEAQLHDAQELLQEETRAKLALGSRVRAMEAEAAGLREQLEEEAAARERAG
RELQTAQAQLSEWRRRQEEEAGALEAGEEARRRAAREAEALTQRLAEKTETVDRLERGRR
RLQQELDDATMDLEQQRQLVSTLEKKQRKFDQLLAEEKAAVLRAVEERERAEAEGREREA
RALSLTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKSVHELERACRVAEQAAND
LRAQVTELEDELTAAEDAKLRLEVTVQALKTQHERDLQGRDEAGEERRRQLAKQLRDAEV
ERDEERKQRTLAVAARKKLEGELEELKAQMASAGQGKEEAVKQLRKMQAQMKELWREVEE
TRTSREEIFSQNRESEKRLKGLEAEVLRLQEELAASDRARRQAQQDRDEMADEVANGNLS
KAAILEEKRQLEGRLGQLEEELEEEQSNSELLNDRYRKLLLQVESLTTELSAERSFSAKA
ESGRQQLERQIQELRGRLGEEDAGARARHKMTIAALESKLAQAEEQLEQETRERILSGKL
VRRAEKRLKEVVLQVEEERRVADQLRDQLEKGNLRVKQLKRQLEEAEEEASRAQAGRRRL
QRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEAEEAQPGS
GPSPEPEGSPPAHPQ
NT seq 5988 nt   +upstreamnt  +downstreamnt
atggcagccgtgaccatgtcggtgcccgggcggaaggcgccccccaggccgggcccagtg
cccgaggcggcccagccgttcctgttcacgccccgcgggcccagcgcgggtggcgggcct
ggctcgggcacctccccgcaggtggagtggacggcccggcgtctcgtgtgggtgccttcg
gagcttcacgggttcgaggcggcggcgctgcgggacgaaggcgaggaggaggcggaggtg
gagctggcggagagcgggaggcggctgcgactgccgcgggaccagatccagcgcatgaac
ccgcccaagttcagcaaggccgaggacatggccgagctgacctgcctcaacgaggcctcg
gtcctgcacaacctccgggagcggtactactccggcctcatctacacgtactccggcctt
ttctgtgtggtcatcaacccgtacaagcagcttcccatctacacagaagccattgtggag
atgtaccggggcaagaagcgccacgaggtgccaccccacgtgtacgcagtgaccgagggg
gcctatcggagcatgctgcaggatcgtgaggaccagtccattctctgcactggagagtct
ggagctgggaagacggaaaacaccaagaaggtcatccagtacctcgcccacgtggcgtcg
tctccaaagggcaggaaggagccgggtgtccccggtgagctggagcggcagctgcttcag
gccaaccccatcctagaggcctttggcaatgccaagacagtgaagaatgacaactcctcc
cgattcggcaaattcatccgcatcaactttgatgttgccgggtacatcgtgggcgccaac
attgagacctacctgctggagaagtcgcgggccatccgccaggccaaggacgagtgcagc
ttccacatcttctaccagctgctggggggcgctggagagcagctcaaagccgacctcctc
ctcgagccctgctcccactaccggttcctgaccaacgggccgtcatcctctcccggccag
gagcgggaactcttccaggagacgctggagtcgctgcgggtcctgggattcagccacgag
gaaatcatctccatgctgcggatggtctcagcagttctccagtttggcaacattgccttg
aagagagaacggaacaccgatcaagccaccatgcctgacaacacagctgcacagaagctc
tgccgcctcttgggactgggggtgacggatttctcccgagccttgctcacccctcgcatc
aaagttggccgagactatgtgcagaaagcccagactaaggaacaggctgacttcgcgctg
gaggccctggccaaggccacctacgagcgcctcttccgctggctggttctgcgcctcaac
cgggccttggaccgcagcccccgccaaggcgcctccttcctgggcatcctggacatcgcg
ggctttgagatcttccagctgaactccttcgagcagctctgcatcaactacaccaacgag
aagctgcagcagctcttcaaccacaccatgttcgtgctggagcaggaggagtaccagcgt
gagggcatcccctggaccttcctcgactttggcctcgacctgcagccctgcatcgacctc
atcgagcggccggccaacccccctggactcctggccctgctggatgaggagtgctggttc
ccgaaggccacagacaagtcgtttgtggagaaggtagcccaggagcagggcggccacccc
aagttccagcggccgaggcacctgcgggatcaggccgacttcagtgttctccactacgcg
ggcaaggtcgactacaaggccaacgagtggctgatgaaaaacatggaccctctgaatgac
aacgtcgcagccttgctccaccagagcacagaccggctgacggcagagatctggaaagac
gtggagggcatcgtggggctggaacaggtgagcagcctgggcgacggcccaccaggtggc
cgcccccgtcggggtatgttccggacagtgggacagctctacaaggagtccctgagccgc
ctcatggccacactcagcaacaccaaccccagttttgtccgctgcattgtccccaaccac
gagaagagggccgggaagctggagccacggctggtgctggaccagcttcgctgcaacggg
gtcctggagggcatccgcatctgtcgccagggcttccccaaccgcatcctcttccaggag
ttccggcagcgatacgagatcctgacacccaatgccatccccaagggcttcatggatggg
aagcaggcctgtgaaaagatgatccaggcgctggaactggaccccaacctctaccgcgtg
ggacagagcaagatcttcttccgggctggggtcctggcccagctggaagaggagcgagac
ctgaaggtcaccgacatcatcgtctccttccaggcagctgcccggggatacctggctcgc
agggccttccagaagcgccagcagcagcagagcgccctgagggtgatgcagcggaactgc
gcggcctacctcaagctgagacactggcagtggtggcggctgtttaccaaggtgaagcca
ctgctgcaggtgacgcggcaggatgaggtgctgcaggcacgggcccaggagctgcagaaa
gtgcaggagctacagcagcagagcgcccgcgaagttggggagctccagggccgagtggca
cagctggaagaggagcgcgcccgcctggcagagcaattgcgagcagaggcagaactgtgt
gcagaggccgaggagacgcgggggaggctggcagcccgcaagcaggagctggagctggtg
gtgtcagagctggaggctcgcgtgggcgaggaggaggagtgcagccgtcaaatgcaaacc
gagaagaagaggctgcagcagcacatacaggagctagaggcccaccttgaggctgaggag
ggtgcgcggcagaagctgcagctggagaaggtgacgacagaggcaaaaatgaagaaattt
gaagaggacctgctgctcctggaagaccagaattccaagctgagcaaggagcggaagctg
ctggaagatcgtctggccgagttctcatcccaggcagctgaggaggaggagaaggtcaag
agcctcaataagctacggctcaaatatgaggccacaatcgcagacatggaggaccgccta
cggaaggaggagaagggtcgccaggagctggagaagctgaagcggaggctggatggggag
agctcagagctgcaggagcagatggtggagcagcaacagcgggcagaggagctgcgggcc
cagctgggccggaaggaggaggagctgcaggctgccctggccagggcagaagacgagggt
ggggcccgggcccagctgctgaaatccctgcgggaggctcaagcagccctggccgaggcc
caggaggacctggagtctgagcgtgtggccaggaccaaggcggagaagcagcgccgggac
ctgggcgaggagctggaggcgctgcggggcgagctggaggacacgctggactccaccaac
gcacagcaggagctccggtccaagagggaacaggaggtgacggagctgaagaagactctg
gaggaggagactcgcatccacgaggcggcagtgcaggagctgaggcagcgccacggccag
gccctgggggagctggcggagcagctggagcaggcccggaggggcaaaggtgcatgggag
aagacccggctggccctggaggccgaggtgtccgagctgcgggcagaactgagcagcctg
cagactgcacgtcaggagggtgagcagcggaggcgccgcctggagttacagctgcaggag
gtgcagggccgggctggtgatggggagagggcacgagcggaggctgctgagaagctgcag
cgagcccaggctgaactggagaatgtgtctggggcgctgaacgaggctgagtccaaaacc
atccgtcttagcaaggagctgagcagcacagaagcccagctgcacgatgcccaggagctg
ctgcaggaggagaccagggcgaaattggccttggggtcccgggtgcgagccatggaggct
gaggcagccgggctgcgtgagcagctggaggaggaggcagctgccagggaacgggcgggc
cgtgaactgcagactgcccaggcccagctttccgagtggcggcggcgccaggaggaggag
gcaggggcactggaggcaggggaggaggcacggcgccgggcagcccgggaggccgaggcc
ctgacccagcgcctggcagaaaagacagagaccgtggatcggctggagcggggccgccgc
cggctgcagcaggagctggacgacgccaccatggacctggagcagcagcggcagcttgtg
agcaccctggagaagaagcagcgcaagtttgaccagcttctggcagaggagaaggcagct
gtacttcgggcagtggaggaacgtgagcgggccgaggcagagggccgggagcgtgaggct
cgggccctgtcactgacacgggcactggaggaggagcaggaggcacgtgaggagctggag
cggcagaaccgggccctgcgggctgagctggaggcactgctgagcagcaaggatgacgtc
ggcaagagcgtgcatgagctggaacgagcctgccgggtagcagaacaggcagccaatgat
ctgcgagcacaggtgacagaactggaggatgagctgacagcggccgaggatgccaagctg
cgtctggaggtgactgtgcaggctctcaagactcagcatgagcgtgacctgcagggccgt
gatgaggctggtgaagagaggcggaggcagctggccaagcagctgagagatgcagaggtg
gagcgggatgaggagcggaagcagcgcactctggccgtggctgcccgcaagaagctggag
ggagagctggaggagctgaaggctcagatggcctctgccggccagggcaaggaggaggcg
gtgaagcagcttcgcaagatgcaggcccagatgaaggagctatggcgggaggtggaggag
acacgcacctcccgggaggagatcttctcccagaatcgggaaagtgaaaagcgcctcaag
ggcctggaggctgaggtgctgcggctgcaggaggaactggccgcctcggaccgtgctcgg
cggcaggcccagcaggaccgggatgagatggcagatgaggtggccaatggtaaccttagc
aaggcagccattctggaggagaagcgtcagctggaggggcgcctggggcagttggaggaa
gagctggaggaggagcagagcaactcggagctgctcaatgaccgctaccgcaagctgctc
ctgcaggtagagtcactgaccacagagctgtcagctgagcgcagtttctcagccaaggca
gagagcgggcggcagcagctggaacggcagatccaggagctacggggacgcctgggtgag
gaggatgctggggcccgtgcccgccacaagatgaccattgctgcccttgagtctaagttg
gcccaggctgaggagcagctagagcaagagaccagagagcgcatcctctctggaaagctg
gtgcgcagagctgagaagcggcttaaagaggtggtgctccaggtggaggaggagcggagg
gtggctgaccagctccgggaccagctggagaagggaaaccttcgagtcaagcagctgaag
cggcagctggaggaggccgaggaggaggcatcccgggctcaggccggccgccggaggctg
cagcgtgagctggaagatgtcacagagtcggccgagtccatgaaccgtgaagtgaccaca
ctgaggaaccggcttcgacgcggccccctcaccttcaccacccgcacggtgcgccaggtc
ttccgactagaggagggcgtggcatccgacgaggaggcagaggaagcacagcctgggtct
gggccatccccggagcctgaggggtccccaccagcccacccccagtga

DBGET integrated database retrieval system