KEGG   Homo sapiens (human): 103910Help
Entry
103910            CDS       T01001                                 

Gene name
MYL12B, MLC-B, MRLC2
Definition
(RefSeq) myosin light chain 12B
  KO
K12757  myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103910 (MYL12B)
   04530 Tight junction
    103910 (MYL12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103910 (MYL12B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103910 (MYL12B)
   04670 Leukocyte transendothelial migration
    103910 (MYL12B)
  09158 Development and regeneration
   04360 Axon guidance
    103910 (MYL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    103910 (MYL12B)
   04147 Exosome [BR:hsa04147]
    103910 (MYL12B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     103910 (MYL12B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   103910 (MYL12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 UPF0154 SPARC_Ca_bdg DUF2666 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 103910
NCBI-ProteinID: NP_001138416
OMIM: 609211
HGNC: 29827
Ensembl: ENSG00000118680
Vega: OTTHUMG00000131510
UniProt: O14950
LinkDB All DBs
Position
18p11.31
AA seq 172 aa AA seqDB search
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaaaggcaaagaccaagaccaccaagaagcgccctcagcgtgcaacatcc
aatgtgtttgccatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatg
attgatcagaacagagatggcttcatcgacaaggaagatttgcatgatatgcttgcttct
ctagggaagaatcccactgatgcataccttgatgccatgatgaatgaggccccagggccc
atcaatttcaccatgttcctgaccatgtttggtgagaagttaaatggcacagatcctgaa
gatgtcatcagaaacgcctttgcttgctttgatgaagaagcaacaggcaccattcaggaa
gattacctaagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggat
gagctgtacagagaagcacctattgacaaaaaggggaatttcaattacatcgagttcaca
cgcatcctgaaacatggagccaaagacaaagatgactga

KEGG   Homo sapiens (human): 10398Help
Entry
10398             CDS       T01001                                 

Gene name
MYL9, LC20, MLC-2C, MLC2, MRLC1, MYRL2
Definition
(RefSeq) myosin light chain 9
  KO
K12755  myosin regulatory light chain 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10398 (MYL9)
   04022 cGMP-PKG signaling pathway
    10398 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10398 (MYL9)
   04530 Tight junction
    10398 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10398 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    10398 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    10398 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10398 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    10398 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10398 (MYL9)
   04147 Exosome [BR:hsa04147]
    10398 (MYL9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10398 (MYL9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   10398 (MYL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH Syntaxin SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 10398
NCBI-ProteinID: NP_006088
OMIM: 609905
HGNC: 15754
Ensembl: ENSG00000101335
Vega: OTTHUMG00000032387
Pharos: P24844(Tbio)
UniProt: P24844 A0A384NY64
LinkDB All DBs
Position
20q11.23
AA seq 172 aa AA seqDB search
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagcgggccaaagccaagaccaccaagaagcggccacagcgggccacatcc
aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggctttcaacatg
attgaccagaaccgtgatggcttcattgacaaggaggacctgcacgacatgctggcctcg
ctggggaagaaccccacagacgaatacctggagggcatgatgagcgaggccccggggccc
atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacggaccccgag
gatgtgattcgcaacgcctttgcctgcttcgacgaggaagcctcaggtttcatccatgag
gaccacctccgggagctgctcaccaccatgggtgaccgcttcacagatgaggaagtggac
gagatgtaccgggaggcacccattgataagaaaggcaacttcaactacgtggagttcacc
cgcatcctcaaacatggcgccaaggataaagacgactag

KEGG   Homo sapiens (human): 10627Help
Entry
10627             CDS       T01001                                 

Gene name
MYL12A, HEL-S-24, MLC-2B, MLCB, MRCL3, MRLC3, MYL2B
Definition
(RefSeq) myosin light chain 12A
  KO
K12757  myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10627 (MYL12A)
   04530 Tight junction
    10627 (MYL12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10627 (MYL12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    10627 (MYL12A)
   04670 Leukocyte transendothelial migration
    10627 (MYL12A)
  09158 Development and regeneration
   04360 Axon guidance
    10627 (MYL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10627 (MYL12A)
   04147 Exosome [BR:hsa04147]
    10627 (MYL12A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10627 (MYL12A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   10627 (MYL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF2666
Motif
Other DBs
NCBI-GeneID: 10627
NCBI-ProteinID: NP_001289976
HGNC: 16701
Ensembl: ENSG00000101608
Vega: OTTHUMG00000131509
Pharos: P19105(Tbio)
UniProt: P19105
LinkDB All DBs
Position
18p11.31
AA seq 171 aa AA seqDB search
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED
YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaagaacaaagaccaagaccaagaagcgccctcagcgtgcaacatccaat
gtgtttgctatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatgatt
gatcagaacagagatggtttcatcgacaaggaagatttgcatgatatgcttgcttcattg
gggaagaatccaactgatgagtatctagatgccatgatgaatgaggctccaggccccatc
aatttcaccatgttcctcaccatgtttggtgagaagttaaatggcacagatcctgaagat
gtcatcagaaatgcctttgcttgctttgatgaagaagcaactggcaccatacaggaagat
tacttgagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggatgag
ctgtacagagaagcacctattgataaaaaggggaatttcaattacatcgagttcacacgc
atcctgaaacatggagccaaagacaaagatgactga

KEGG   Homo sapiens (human): 29895Help
Entry
29895             CDS       T01001                                 

Gene name
MYLPF, HUMMLC2B, MLC2B, MRLC2, MYL11
Definition
(RefSeq) myosin light chain, phosphorylatable, fast skeletal muscle
  KO
K12758  fast skeletal myosin light chain 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29895 (MYLPF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29895 (MYLPF)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    29895 (MYLPF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    29895 (MYLPF)
   04147 Exosome [BR:hsa04147]
    29895 (MYLPF)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     29895 (MYLPF)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   29895 (MYLPF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 29895
NCBI-ProteinID: NP_001311387
OMIM: 617378
HGNC: 29824
Ensembl: ENSG00000180209
Vega: OTTHUMG00000132399
Pharos: Q96A32(Tbio)
UniProt: Q96A32 A0A024QZG6
LinkDB All DBs
Position
16p11.2
AA seq 169 aa AA seqDB search
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaagagggccaagagaaggacagtagagggcggaagctccagcgtcttctcc
atgttcgaccagactcagatccaggagttcaaagaggccttcactgtgatcgaccagaac
cgtgatggtattatagacaaggaggaccttcgggacaccttcgcagccatgggccgcctc
aatgtgaagaatgaggagttggatgccatgatgaaggaagccagcggtcccatcaacttc
accgtcttcctgaccatgttcggggagaagctcaagggtgccgaccctgaggatgtgatc
accggagccttcaaggtcttggaccctgagggaaagggcaccatcaagaagaagttcctg
gaggagctgctgaccacgcagtgtgaccgcttctcccaggaggagatcaagaacatgtgg
gcggccttcccccccgacgtgggcggcaacgtcgactacaaaaacatctgctacgtcatc
acgcacggcgacgccaaggaccaggagtag

KEGG   Homo sapiens (human): 4633Help
Entry
4633              CDS       T01001                                 

Gene name
MYL2, CMH10, MLC-2s/v, MLC2
Definition
(RefSeq) myosin light chain 2
  KO
K10351  myosin regulatory light chain 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00292  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    4633 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    4633 (MYL2)
   04530 Tight junction
    4633 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4633 (MYL2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    4633 (MYL2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4633 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    4633 (MYL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    4633 (MYL2)
   05414 Dilated cardiomyopathy (DCM)
    4633 (MYL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4633 (MYL2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4633 (MYL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 4633
NCBI-ProteinID: NP_000423
OMIM: 160781
HGNC: 7583
Ensembl: ENSG00000111245
Vega: OTTHUMG00000169535
Pharos: P10916(Tbio)
UniProt: P10916 Q6IB42
LinkDB All DBs
Structure
PDB: 

Position
12q24.11
AA seq 166 aa AA seqDB search
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcacctaagaaagcaaagaagagagccgggggcgccaactccaacgtgttctccatg
ttcgaacagacccaaatccaggaatttaaggaggccttcactatcatggaccagaacagg
gatggcttcattgacaagaacgatctgagagacacctttgctgcccttgggcgagtgaac
gtgaaaaatgaagaaattgatgaaatgatcaaggaggctccgggtccaattaactttact
gtgttcctcacaatgtttggggagaaacttaagggagcggaccctgaggaaaccattctc
aacgcattcaaagtgtttgaccctgaaggcaaaggggtgctgaaggctgattacgttcgg
gaaatgctgaccacgcaggcggagaggttttccaaggaggaggttgaccagatgttcgcc
gccttcccccctgacgtgactggcaacttggactacaagaacctggtgcacatcatcacc
cacggagaagagaaggactag

KEGG   Homo sapiens (human): 4636Help
Entry
4636              CDS       T01001                                 

Gene name
MYL5, MYLC2
Definition
(RefSeq) myosin light chain 5
  KO
K12753  myosin regulatory light chain 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    4636 (MYL5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4636 (MYL5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    4636 (MYL5)
  09158 Development and regeneration
   04360 Axon guidance
    4636 (MYL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4636 (MYL5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4636 (MYL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 DUF945 Lipoprotein_6 Caleosin SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 4636
NCBI-ProteinID: NP_002468
OMIM: 160782
HGNC: 7586
Ensembl: ENSG00000215375
Vega: OTTHUMG00000159971
Pharos: Q02045(Tdark)
UniProt: Q02045
LinkDB All DBs
Position
4p16.3
AA seq 173 aa AA seqDB search
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcctca
tccaatgtcttctccaactttgagcagactcagatccaggagttcaaggaggcattcaca
ctcatggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctatgcc
tccctgggcaagaccaacgtcaaggacgacgagctggacgccatgctcaaagaggcctcg
gggcccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgac
gccgaggagaccattcttaacgccttcaagatgctggacccggacgggaaagggaaaatc
aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacggcggaagag
gtggaccagatgttccagttcgcctccatcgatgtggcgggcaacctggactacaaggcg
ctcagctacgtgatcacccacggggaggagaaggaggagtga

KEGG   Homo sapiens (human): 58498Help
Entry
58498             CDS       T01001                                 

Gene name
MYL7, MYL2A, MYLC2A
Definition
(RefSeq) myosin light chain 7
  KO
K12754  myosin regulatory light chain 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    58498 (MYL7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    58498 (MYL7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    58498 (MYL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    58498 (MYL7)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     58498 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 EF-hand_5 CHCH EF-hand_9
Motif
Other DBs
NCBI-GeneID: 58498
NCBI-ProteinID: NP_067046
OMIM: 613993
HGNC: 21719
Ensembl: ENSG00000106631
Vega: OTTHUMG00000023125
Pharos: Q01449(Tdark)
UniProt: Q01449
LinkDB All DBs
Position
7p13
AA seq 175 aa AA seqDB search
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccggggcaaggtggcagccaccaagcaggcccaacgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatacaggagttcaaagaagcc
ttcagctgtatcgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc
tactcccagctggggaaggtgagtgtcccagaggaggagctggacgccatgctgcaagag
ggcaagggccccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg
acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagcggcaaaggg
gtggtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaagttctctcca
gctgaggtggagcagatgttcgccctgacacccatggacctggcggggaacatcgactac
aagtcactgtgctacatcatcacccatggagacgagaaagaggaatga

KEGG   Homo sapiens (human): 93408Help
Entry
93408             CDS       T01001                                 

Gene name
MYL10, MYLC2PL, PLRLC
Definition
(RefSeq) myosin light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    93408 (MYL10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    93408 (MYL10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    93408 (MYL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    93408 (MYL10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     93408 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 TC1
Motif
Other DBs
NCBI-GeneID: 93408
NCBI-ProteinID: NP_612412
OMIM: 617177
HGNC: 29825
Ensembl: ENSG00000106436
Vega: OTTHUMG00000157137
Pharos: Q9BUA6(Tdark)
UniProt: Q9BUA6
LinkDB All DBs
Position
7q22.1
AA seq 226 aa AA seqDB search
MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLA
LSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRIN
VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIK
EKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttaggctggtctcaaactcctggcctcaagtgatcctccctcctcggcctccc
aaagtgctgggattacaggcaccgagaagagctcggaaaagagcagaaggcaccgccagc
tccaacgtcttctccatgtttgatcagtcccagatccaggagtttaaagagagtctggct
ctgtcgcccaggctggagcgcaatggcatgatctcggctcactgcaacctctgcctcacg
ggttcaagcaattctcctgcctcagcctcccaagctttcaccatcatggaccagaaccgt
gatggcttcatcgacaaagaggacttgagggacacctttgccgcgctgggccgcatcaat
gtcaagaacgaggaactggaggccatggtgaaggaggcccccggacccatcaacttcacg
gtgttcctgaccatgtttggggagaagctgaagggcacggacccagaggagaccattctc
cacgccttcaaagtgttcgacactgaagggaaaggtttcgtcaaggccgatgtcatcaaa
gaaaaacttatgacccaggcagaccgcttcagtgaggaggaggtcaagcagatgtttgca
gcatttcccccagatgtgtgcggcaacctggactacagaaacctgtgctacgtcatcact
cacggtgaagagaaggattag

DBGET integrated database retrieval system