KEGG   Homo sapiens (human): 103910Help
Entry
103910            CDS       T01001                                 

Gene name
MYL12B, MLC-B, MRLC2
Definition
(RefSeq) myosin light chain 12B
  KO
K12757  myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103910 (MYL12B)
   04530 Tight junction
    103910 (MYL12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103910 (MYL12B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103910 (MYL12B)
   04670 Leukocyte transendothelial migration
    103910 (MYL12B)
  09158 Development and regeneration
   04360 Axon guidance
    103910 (MYL12B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    103910 (MYL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    103910 (MYL12B)
   04147 Exosome [BR:hsa04147]
    103910 (MYL12B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     103910 (MYL12B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   103910 (MYL12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 UPF0154 SPARC_Ca_bdg DUF2666 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 103910
NCBI-ProteinID: NP_001138416
OMIM: 609211
HGNC: 29827
Ensembl: ENSG00000118680
Vega: OTTHUMG00000131510
UniProt: O14950
LinkDB All DBs
Position
18p11.31
AA seq 172 aa AA seqDB search
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaaaggcaaagaccaagaccaccaagaagcgccctcagcgtgcaacatcc
aatgtgtttgccatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatg
attgatcagaacagagatggcttcatcgacaaggaagatttgcatgatatgcttgcttct
ctagggaagaatcccactgatgcataccttgatgccatgatgaatgaggccccagggccc
atcaatttcaccatgttcctgaccatgtttggtgagaagttaaatggcacagatcctgaa
gatgtcatcagaaacgcctttgcttgctttgatgaagaagcaacaggcaccattcaggaa
gattacctaagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggat
gagctgtacagagaagcacctattgacaaaaaggggaatttcaattacatcgagttcaca
cgcatcctgaaacatggagccaaagacaaagatgactga

KEGG   Homo sapiens (human): 10398Help
Entry
10398             CDS       T01001                                 

Gene name
MYL9, LC20, MLC-2C, MLC2, MRLC1, MYRL2
Definition
(RefSeq) myosin light chain 9
  KO
K12755  myosin regulatory light chain 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10398 (MYL9)
   04022 cGMP-PKG signaling pathway
    10398 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10398 (MYL9)
   04530 Tight junction
    10398 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10398 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    10398 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    10398 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10398 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    10398 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10398 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10398 (MYL9)
   04147 Exosome [BR:hsa04147]
    10398 (MYL9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10398 (MYL9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   10398 (MYL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH Syntaxin SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 10398
NCBI-ProteinID: NP_006088
OMIM: 609905
HGNC: 15754
Ensembl: ENSG00000101335
Vega: OTTHUMG00000032387
Pharos: P24844(Tbio)
UniProt: P24844 A0A384NY64
LinkDB All DBs
Position
20q11.23
AA seq 172 aa AA seqDB search
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagcgggccaaagccaagaccaccaagaagcggccacagcgggccacatcc
aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggctttcaacatg
attgaccagaaccgtgatggcttcattgacaaggaggacctgcacgacatgctggcctcg
ctggggaagaaccccacagacgaatacctggagggcatgatgagcgaggccccggggccc
atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacggaccccgag
gatgtgattcgcaacgcctttgcctgcttcgacgaggaagcctcaggtttcatccatgag
gaccacctccgggagctgctcaccaccatgggtgaccgcttcacagatgaggaagtggac
gagatgtaccgggaggcacccattgataagaaaggcaacttcaactacgtggagttcacc
cgcatcctcaaacatggcgccaaggataaagacgactag

KEGG   Homo sapiens (human): 10627Help
Entry
10627             CDS       T01001                                 

Gene name
MYL12A, HEL-S-24, MLC-2B, MLCB, MRCL3, MRLC3, MYL2B
Definition
(RefSeq) myosin light chain 12A
  KO
K12757  myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10627 (MYL12A)
   04530 Tight junction
    10627 (MYL12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10627 (MYL12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    10627 (MYL12A)
   04670 Leukocyte transendothelial migration
    10627 (MYL12A)
  09158 Development and regeneration
   04360 Axon guidance
    10627 (MYL12A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10627 (MYL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10627 (MYL12A)
   04147 Exosome [BR:hsa04147]
    10627 (MYL12A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10627 (MYL12A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   10627 (MYL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF2666
Motif
Other DBs
NCBI-GeneID: 10627
NCBI-ProteinID: NP_001289976
HGNC: 16701
Ensembl: ENSG00000101608
Vega: OTTHUMG00000131509
Pharos: P19105(Tbio)
UniProt: P19105
LinkDB All DBs
Position
18p11.31
AA seq 171 aa AA seqDB search
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED
YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaagaacaaagaccaagaccaagaagcgccctcagcgtgcaacatccaat
gtgtttgctatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatgatt
gatcagaacagagatggtttcatcgacaaggaagatttgcatgatatgcttgcttcattg
gggaagaatccaactgatgagtatctagatgccatgatgaatgaggctccaggccccatc
aatttcaccatgttcctcaccatgtttggtgagaagttaaatggcacagatcctgaagat
gtcatcagaaatgcctttgcttgctttgatgaagaagcaactggcaccatacaggaagat
tacttgagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggatgag
ctgtacagagaagcacctattgataaaaaggggaatttcaattacatcgagttcacacgc
atcctgaaacatggagccaaagacaaagatgactga

KEGG   Homo sapiens (human): 4636Help
Entry
4636              CDS       T01001                                 

Gene name
MYL5, MYLC2
Definition
(RefSeq) myosin light chain 5
  KO
K12753  myosin regulatory light chain 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    4636 (MYL5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4636 (MYL5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    4636 (MYL5)
  09158 Development and regeneration
   04360 Axon guidance
    4636 (MYL5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    4636 (MYL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4636 (MYL5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4636 (MYL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 DUF945 Lipoprotein_6 Caleosin SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 4636
NCBI-ProteinID: NP_002468
OMIM: 160782
HGNC: 7586
Ensembl: ENSG00000215375
Vega: OTTHUMG00000159971
Pharos: Q02045(Tdark)
UniProt: Q02045
LinkDB All DBs
Position
4p16.3
AA seq 173 aa AA seqDB search
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcctca
tccaatgtcttctccaactttgagcagactcagatccaggagttcaaggaggcattcaca
ctcatggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctatgcc
tccctgggcaagaccaacgtcaaggacgacgagctggacgccatgctcaaagaggcctcg
gggcccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgac
gccgaggagaccattcttaacgccttcaagatgctggacccggacgggaaagggaaaatc
aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacggcggaagag
gtggaccagatgttccagttcgcctccatcgatgtggcgggcaacctggactacaaggcg
ctcagctacgtgatcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system