KEGG   Homo sapiens (human): 10392
Entry
10392             CDS       T01001                                 

Gene name
NOD1, CARD4, CLR7.1, NLRC1
Definition
(RefSeq) nucleotide binding oligomerization domain containing 1
  KO
K08727  nucleotide-binding oligomerization domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
Network
nt06139  NLR signaling (viruses and bacteria)
  Element
N00940  NOD-NFKB signaling pathway
N01112  Salmonella SopE/E2 to NOD-NFKB signaling pathway
Disease
H01358  Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    10392 (NOD1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    10392 (NOD1)
   05132 Salmonella infection
    10392 (NOD1)
   05131 Shigellosis
    10392 (NOD1)
   05133 Pertussis
    10392 (NOD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    10392 (NOD1)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   10392 (NOD1)
SSDB
Motif
Pfam: NACHT LRR_6 CARD NLRC4_HD2 LRR_4 NOD2_WH AAA_16 ABC_tran AAA_18 RsgA_GTPase AAA_22 Roc
Other DBs
NCBI-GeneID: 10392
NCBI-ProteinID: NP_006083
OMIM: 605980
HGNC: 16390
Ensembl: ENSG00000106100
Vega: OTTHUMG00000023923
Pharos: Q9Y239(Tchem)
UniProt: Q9Y239 A0A024RA73
LinkDB
Structure
PDB: 

Position
7p14.3
AA seq 953 aa
MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAY
ARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQEL
LRFFQEWMPPAGAATTSCYPPFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGV
RELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF
NT seq 2862 nt   +upstreamnt  +downstreamnt
atggaagagcagggccacagtgagatggaaataatcccatcagagtctcacccccacatt
caattactgaaaagcaatcgggaacttctggtcactcacatccgcaatactcagtgtctg
gtggacaacttgctgaagaatgactacttctcggccgaagatgcggagattgtgtgtgcc
tgccccacccagcctgacaaggtccgcaaaattctggacctggtacagagcaagggcgag
gaggtgtccgagttcttcctctacttgctccagcaactcgcagatgcctacgtggacctc
aggccttggctgctggagatcggcttctccccttccctgctcactcagagcaaagtcgtg
gtcaacactgacccagtgagcaggtatacccagcagctgcgacaccatctgggccgtgac
tccaagttcgtgctgtgctatgcccagaaggaggagctgctgctggaggagatctacatg
gacaccatcatggagctggttggcttcagcaatgagagcctgggcagcctgaacagcctg
gcctgcctcctggaccacaccaccggcatcctcaatgagcagggtgagaccatcttcatc
ctgggtgatgctggggtgggcaagtccatgctgctacagcggctgcagagcctctgggcc
acgggccggctagacgcaggggtcaaattcttcttccactttcgctgccgcatgttcagc
tgcttcaaggaaagtgacaggctgtgtctgcaggacctgctcttcaagcactactgctac
ccagagcgggaccccgaggaggtgtttgccttcctgctgcgcttcccccacgtggccctc
ttcaccttcgatggcctggacgagctgcactcggacttggacctgagccgcgtgcctgac
agctcctgcccctgggagcctgcccaccccctggtcttgctggccaacctgctcagtggg
aagctgctcaagggggctagcaagctgctcacagcccgcacaggcatcgaggtcccgcgc
cagttcctgcggaagaaggtgcttctccggggcttctcccccagccacctgcgcgcctat
gccaggaggatgttccccgagcgggccctgcaggaccgcctgctgagccagctggaggcc
aaccccaacctctgcagcctgtgctctgtgcccctcttctgctggatcatcttccggtgc
ttccagcacttccgtgctgcctttgaaggctcaccacagctgcccgactgcacgatgacc
ctgacagatgtcttcctcctggtcactgaggtccatctgaacaggatgcagcccagcagc
ctggtgcagcggaacacacgcagcccagtggagaccctccacgccggccgggacactctg
tgctcgctggggcaggtggcccaccggggcatggagaagagcctctttgtcttcacccag
gaggaggtgcaggcctccgggctgcaggagagagacatgcagctgggcttcctgcgggct
ttgccggagctgggccccgggggtgaccagcagtcctatgagtttttccacctcaccctc
caggccttctttacagccttcttcctcgtgctggacgacagggtgggcactcaggagctg
ctcaggttcttccaggagtggatgccccctgcgggggcagcgaccacgtcctgctatcct
cccttcctcccgttccagtgcctgcagggcagtggtccggcgcgggaagacctcttcaag
aacaaggatcacttccagttcaccaacctcttcctgtgcgggctgttgtccaaagccaaa
cagaaactcctgcggcatctggtgcccgcggcagccctgaggagaaagcgcaaggccctg
tgggcacacctgttttccagcctgcggggctacctgaagagcctgccccgcgttcaggtc
gaaagcttcaaccaggtgcaggccatgcccacgttcatctggatgctgcgctgcatctac
gagacacagagccagaaggtggggcagctggcggccaggggcatctgcgccaactacctc
aagctgacctactgcaacgcctgctcggccgactgcagcgccctctccttcgtcctgcat
cacttccccaagcggctggccctagacctagacaacaacaatctcaacgactacggcgtg
cgggagctgcagccctgcttcagccgcctcactgttctcagactcagcgtaaaccagatc
actgacggtggggtaaaggtgctaagcgaagagctgaccaaatacaaaattgtgacctat
ttgggtttatacaacaaccagatcaccgatgtcggagccaggtacgtcaccaaaatcctg
gatgaatgcaaaggcctcacgcatcttaaactgggaaaaaacaaaataacaagtgaagga
gggaagtatctcgccctggctgtgaagaacagcaaatcaatctctgaggttgggatgtgg
ggcaatcaagttggggatgaaggagcaaaagccttcgcagaggctctgcggaaccacccc
agcttgaccaccctgagtcttgcgtccaacggcatctccacagaaggaggaaagagcctt
gcgagggccctgcagcagaacacgtctctagaaatactgtggctgacccaaaatgaactc
aacgatgaagtggcagagagtttggcagaaatgttgaaagtcaaccagacgttaaagcat
ttatggcttatccagaatcagatcacagctaaggggactgcccagctggcagatgcgtta
cagagcaacactggcataacagagatttgcctaaatggaaacctgataaaaccagaggag
gccaaagtctatgaagatgagaagcggattatctgtttctga

KEGG   Homo sapiens (human): 64127
Entry
64127             CDS       T01001                                 

Gene name
NOD2, ACUG, BLAU, BLAUS, CARD15, CD, CLR16.3, IBD1, NLRC2, NOD2B, PSORAS1, YAOS
Definition
(RefSeq) nucleotide binding oligomerization domain containing 2
  KO
K10165  nucleotide-binding oligomerization domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05152  Tuberculosis
hsa05321  Inflammatory bowel disease
Network
nt06139  NLR signaling (viruses and bacteria)
  Element
N00940  NOD-NFKB signaling pathway
Disease
H00285  Blau syndrome
H00286  Crohn disease
H01227  Inflammatory bowel disease (IBD)
H01309  Sarcoidosis, early-onset
H01358  Atopic dermatitis
Drug target
Inarigivir soproxil: D11385
Mifamurtide: D06619
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    64127 (NOD2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    64127 (NOD2)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    64127 (NOD2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    64127 (NOD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    64127 (NOD2)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   64127 (NOD2)
SSDB
Motif
Pfam: NACHT CARD NLRC4_HD2 LRR_6 NOD2_WH LRR_4 AAA_16 LRR_8 AAA_29 AAA_22 AAA_30 AAA_25 NB-ARC ABC_tran
Other DBs
NCBI-GeneID: 64127
NCBI-ProteinID: NP_071445
OMIM: 605956
HGNC: 5331
Ensembl: ENSG00000167207
Vega: OTTHUMG00000133171
Pharos: Q9HC29(Tclin)
UniProt: Q9HC29
LinkDB
Position
16q12.1
AA seq 1040 aa
MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWL
LSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLH
GCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQR
ARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTY
DGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGE
AGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQ
EDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR
KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALH
GLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLL
RGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLE
FLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVA
ALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFH
SIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECA
ALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL
HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTS
LQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEEL
CLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRG
NTFSLEEVDKLGCRDTRLLL
NT seq 3123 nt   +upstreamnt  +downstreamnt
atgggggaagagggtggttcagcctctcacgatgaggaggaaagagcaagtgtcctcctc
ggacattctccgggttgtgaaatgtgctcgcaggaggcttttcaggcacagaggagccag
ctggtcgagctgctggtctcagggtccctggaaggcttcgagagtgtcctggactggctg
ctgtcctgggaggtcctctcctgggaggactacgagggcttccacctcctgggccagcct
ctctcccacttggccaggcgccttctggacaccgtctggaataagggtacttgggcctgt
cagaagctcatcgcggctgcccaagaagcccaggccgacagccagtcccccaagctgcat
ggctgctgggacccccactcgctccacccagcccgagacctgcagagtcaccggccagcc
attgtcaggaggctccacagccatgtggagaacatgctggacctggcatgggagcggggt
ttcgtcagccagtatgaatgtgatgaaatcaggttgccgatcttcacaccgtcccagagg
gcaagaaggctgcttgatcttgccacggtgaaagcgaatggattggctgccttccttcta
caacatgttcaggaattaccagtcccattggccctgcctttggaagctgccacatgcaag
aagtatatggccaagctgaggaccacggtgtctgctcagtctcgcttcctcagtacctat
gatggagcagagacgctctgcctggaggacatatacacagagaatgtcctggaggtctgg
gcagatgtgggcatggctggacccccgcagaagagcccagccaccctgggcctggaggag
ctcttcagcacccctggccacctcaatgacgatgcggacactgtgctggtggtgggtgag
gcgggcagtggcaagagcacgctcctgcagcggctgcacttgctgtgggctgcagggcaa
gacttccaggaatttctctttgtcttcccattcagctgccggcagctgcagtgcatggcc
aaaccactctctgtgcggactctactctttgagcactgctgttggcctgatgttggtcaa
gaagacatcttccagttactccttgaccaccctgaccgtgtcctgttaacctttgatggc
tttgacgagttcaagttcaggttcacggatcgtgaacgccactgctccccgaccgacccc
acctctgtccagaccctgctcttcaaccttctgcagggcaacctgctgaagaatgcccgc
aaggtggtgaccagccgtccggccgctgtgtcggcgttcctcaggaagtacatccgcacc
gagttcaacctcaagggcttctctgaacagggcatcgagctgtacctgaggaagcgccat
catgagcccggggtggcggaccgcctcatccgcctgctccaagagacctcagccctgcac
ggtttgtgccacctgcctgtcttctcatggatggtgtccaaatgccaccaggaactgttg
ctgcaggagggggggtccccaaagaccactacagatatgtacctgctgattctgcagcat
tttctgctgcatgccacccccccagactcagcttcccaaggtctgggacccagtcttctt
cggggccgcctccccaccctcctgcacctgggcagactggctctgtggggcctgggcatg
tgctgctacgtgttctcagcccagcagctccaggcagcacaggtcagccctgatgacatt
tctcttggcttcctggtgcgtgccaaaggtgtcgtgccagggagtacggcgcccctggaa
ttccttcacatcactttccagtgcttctttgccgcgttctacctggcactcagtgctgat
gtgccaccagctttgctcagacacctcttcaattgtggcaggccaggcaactcaccaatg
gccaggctcctgcccacgatgtgcatccaggcctcggagggaaaggacagcagcgtggca
gctttgctgcagaaggccgagccgcacaaccttcagatcacagcagccttcctggcaggg
ctgttgtcccgggagcactggggcctgctggctgagtgccagacatctgagaaggccctg
ctccggcgccaggcctgtgcccgctggtgtctggcccgcagcctccgcaagcacttccac
tccatcccgccagctgcaccgggtgaggccaagagcgtgcatgccatgcccgggttcatc
tggctcatccggagcctgtacgagatgcaggaggagcggctggctcggaaggctgcacgt
ggcctgaatgttgggcacctcaagttgacattttgcagtgtgggccccactgagtgtgct
gccctggcctttgtgctgcagcacctccggcggcccgtggccctgcagctggactacaac
tctgtgggtgacattggcgtggagcagctgctgccttgccttggtgtctgcaaggctctg
tatttgcgcgataacaatatctcagaccgaggcatctgcaagctcattgaatgtgctctt
cactgcgagcaattgcagaagttagctctattcaacaacaaattgactgacggctgtgca
cactccatggctaagctccttgcatgcaggcagaacttcttggcattgaggctggggaat
aactacatcactgccgcgggagcccaagtgctggccgaggggctccgaggcaacacctcc
ttgcagttcctgggattctggggcaacagagtgggtgacgagggggcccaggccctggct
gaagccttgggtgatcaccagagcttgaggtggctcagcctggtggggaacaacattggc
agtgtgggtgcccaagccttggcactgatgctggcaaagaacgtcatgctagaagaactc
tgcctggaggagaaccatctccaggatgaaggtgtatgttctctcgcagaaggactgaag
aaaaattcaagtttgaaaatcctgaagttgtccaataactgcatcacctacctaggggca
gaagccctcctgcaggcccttgaaaggaatgacaccatcctggaagtctggctccgaggg
aacactttctctctagaggaggttgacaagctcggctgcagggacaccagactcttgctt
tga

DBGET integrated database retrieval system