KEGG   Homo sapiens (human): 10393Help
Entry
10393             CDS       T01001                                 

Gene name
ANAPC10, APC10, DOC1
Definition
(RefSeq) anaphase promoting complex subunit 10
  KO
K03357  anaphase-promoting complex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10393 (ANAPC10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10393 (ANAPC10)
   04114 Oocyte meiosis
    10393 (ANAPC10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    10393 (ANAPC10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    10393 (ANAPC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10393 (ANAPC10)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10393 (ANAPC10)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     10393 (ANAPC10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    10393 (ANAPC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Motif
Other DBs
NCBI-GeneID: 10393
NCBI-ProteinID: NP_001243635
OMIM: 613745
HGNC: 24077
Ensembl: ENSG00000164162
Vega: OTTHUMG00000161477
Pharos: Q9UM13(Tbio)
UniProt: Q9UM13
LinkDB All DBs
Structure
PDB: 

Position
4q31.21
AA seq 185 aa AA seqDB search
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgactacaccaaacaagacacctcctggtgctgaccccaagcagttggaaaggactgga
acagtacgggaaattgggtcacaagctgtttggtcactctcatcttgcaaaccaggattt
ggagtggatcagttacgagatgacaatctagaaacttattggcaatcagatggttcccag
cctcatttagtgaacatccaattcagaagaaaaacaacagtgaagacattatgtatttat
gcagactacaaatctgatgaaagctatactccaagcaagatctcagtcagagtaggaaat
aattttcacaaccttcaagaaattcggcaacttgagttggtggaaccaagtggctggatt
catgttcccttaactgacaatcataagaagccaactcgtacattcatgatacagattgct
gttctagccaatcaccagaatggaagagacacccatatgagacaaattaaaatatacaca
ccagtagaagagagctccattggtaaatttcctagatgtacaactatagatttcatgatg
tatcgttcaataaggtga

KEGG   Homo sapiens (human): 246184Help
Entry
246184            CDS       T01001                                 

Gene name
CDC26, ANAPC12, APC12, C9orf17
Definition
(RefSeq) cell division cycle 26
  KO
K03359  anaphase-promoting complex subunit 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    246184 (CDC26)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    246184 (CDC26)
   04114 Oocyte meiosis
    246184 (CDC26)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    246184 (CDC26)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    246184 (CDC26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    246184 (CDC26)
   03036 Chromosome and associated proteins [BR:hsa03036]
    246184 (CDC26)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     246184 (CDC26)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    246184 (CDC26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC_CDC26
Motif
Other DBs
NCBI-GeneID: 246184
NCBI-ProteinID: NP_644815
OMIM: 614533
HGNC: 17839
Ensembl: ENSG00000176386
Vega: OTTHUMG00000020521
Pharos: Q8NHZ8(Tbio)
UniProt: Q8NHZ8 A0A024R832
LinkDB All DBs
Structure
PDB: 

Position
9q32
AA seq 85 aa AA seqDB search
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
INDRIGYKPQPKPNNRSSQFGSLEF
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgctgagacggaaaccaacacgcctagagctaaagcttgatgacattgaagagtttgag
aacattcgaaaggacctggagacccgtaagaaacagaaggaagatgtggaagttgtagga
ggcagtgatggagaaggagccattgggcttagcagtgatcccaagagccgggaacaaatg
atcaatgatcggattggttataaaccccaacccaagcccaataatcgttcatctcaattt
ggaagtcttgaattttag

KEGG   Homo sapiens (human): 29882Help
Entry
29882             CDS       T01001                                 

Gene name
ANAPC2, APC2
Definition
(RefSeq) anaphase promoting complex subunit 2
  KO
K03349  anaphase-promoting complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    29882 (ANAPC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    29882 (ANAPC2)
   04114 Oocyte meiosis
    29882 (ANAPC2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    29882 (ANAPC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29882 (ANAPC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29882 (ANAPC2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    29882 (ANAPC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Cullin
     29882 (ANAPC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    29882 (ANAPC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin ANAPC2
Motif
Other DBs
NCBI-GeneID: 29882
NCBI-ProteinID: NP_037498
OMIM: 606946
HGNC: 19989
Ensembl: ENSG00000176248
Vega: OTTHUMG00000020983
Pharos: Q9UJX6(Tbio)
UniProt: Q9UJX6
LinkDB All DBs
Structure
PDB: 

Position
9q34.3
AA seq 822 aa AA seqDB search
MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVE
VLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLES
RLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCF
LRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWL
GKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIED
LKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVA
CEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIR
NVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEF
WPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVT
PVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMF
VVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagttgtggtggcggagggggacagcgactcccggcccggacaggagttg
ttagtggcctggaacaccgtgagcaccggcctggtgccgccggctgcgctggggctggtg
tcttcccggaccagcggtgcagtcccgccaaaggaagaggagctccgggcggcggtggag
gttctgaggggccacgggctacactcggtcctggaggagtggttcgtggaggtgctgcag
aacgatctgcaggccaacatctcccctgagttctggaatgccatctcccaatgcgagaac
tctgcggatgagccccagtgccttttgctactccttgacgcttttggcctgctggagagc
cgcctggatccctacctgcgtagcctagagctgctggagaaatggactcgcctgggcttg
ctgatgggcactggtgctcaggggctgcgagaagaagtccacactatgttgcgcggagtc
ttgttctttagcacccccagaaccttccaagagatgatccagcgtctgtatgggtgcttc
ttgagagtctatatgcagagtaagaggaagggggaagggggcacagacccggaactggaa
ggggagctggacagccggtatgcccgtcgccggtactaccggctcctgcagagcccgctg
tgtgcagggtgcagcagtgacaagcaacagtgctggtgtcgccaggctctggagcagttc
catcagctcagccaggtcttacacaggctcagtctgctggagcgggtcagtgccgaggct
gtgaccaccaccctgcaccaggtgacccgggagaggatggaggaccgttgccggggcgag
tacgagcgctccttcctgcgtgagttccacaagtggatcgagcgggtggtcggctggctc
ggcaaggtgttcctgcaggacggccccgccaggcccgcatctcccgaggccggcaacacc
ctgcgccgctggcgctgccacgtgcaaaggttcttctaccgcatctacgccagcctgcgc
atcgaggagctcttcagcatcgtccgagacttcccagactcccggccagccatcgaggac
ctcaagtactgcctggagaggacggaccagaggcagcagctgctcgtgtccctcaaggct
gccctggagactcggctcctgcatccaggcgtcaacacgtgtgacatcatcaccctctat
atctctgccatcaaggcgctgcgcgtgctggacccttccatggtcatcctggaggtggcc
tgtgagcctatccgccgctacctgaggacgcgggaggacacagtgcggcagattgtggct
gggctgacgggggactcggacgggacaggggacctggctgttgagctgtccaagaccgac
ccggcgagcctggagacaggccaggacagtgaggatgactcaggcgagccagaggactgg
gtcccggaccctgtggatgccgatccagggaagtcgagctccaagcggcgttcatcggac
atcatcagcctgctggtcagcatctacggcagcaaggacctcttcatcaatgagtaccgc
tcgctgctggccgaccgcctgctgcaccagttcagcttcagccccgagcgggagatccgc
aacgtggagctgctgaagctgcgctttggcgaggccccaatgcacttctgtgaagtcatg
ctgaaggacatggcggactcccgccgcatcaatgccaacatccgggaggaggatgagaag
cggccagcagaggagcagccaccgttcggggtctacgctgtcatcctgtccagtgagttc
tggccgcccttcaaggacgagaagctggaggtccccgaggatatcagggcagccctggag
gcttactgcaagaagtatgagcagctcaaggccatgcggaccctcagttggaagcacacc
ctgggcctggtgaccatggacgtggagctggccgaccgcacgctgtctgtggcggtcacc
ccagtacaggcggtgatcttgctgtattttcaggaccaagccagctggaccctggaggaa
ctgagcaaggcggtgaagatgcccgtggcgctgctgcggcggcggatgtccgtgtggctg
cagcagggtgtgctgcgtgaggagccccccggcaccttctctgtcattgaggaggagcgg
cctcaggaccgggacaacatggtgctcattgacagtgacgacgagagcgactccggcatg
gcctcccaggccgaccagaaggaggaggagctgctgctcttctggacgtacatccaggcc
atgctgaccaacctggagagcctctcactggatcgtatctacaacatgctccgcatgttt
gtggtgactgggcctgcactggccgagattgacctgcaggagctgcagggctacctgcag
aagaaggtgcgggaccagcagctcgtctactcggccggcgtctaccgcctgcccaagaac
tgcagctga

KEGG   Homo sapiens (human): 29945Help
Entry
29945             CDS       T01001                                 

Gene name
ANAPC4, APC4
Definition
(RefSeq) anaphase promoting complex subunit 4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    29945 (ANAPC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    29945 (ANAPC4)
   04114 Oocyte meiosis
    29945 (ANAPC4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    29945 (ANAPC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29945 (ANAPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29945 (ANAPC4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    29945 (ANAPC4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     29945 (ANAPC4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    29945 (ANAPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4 ANAPC4_WD40 RXLR_WY
Motif
Other DBs
NCBI-GeneID: 29945
NCBI-ProteinID: NP_037499
OMIM: 606947
HGNC: 19990
Ensembl: ENSG00000053900
Vega: OTTHUMG00000097753
Pharos: Q9UJX5(Tbio)
UniProt: Q9UJX5
LinkDB All DBs
Structure
PDB: 

Position
4p15.2
AA seq 808 aa AA seqDB search
MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKP
ADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCI
LRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGRE
GRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESE
AENQQAGAAALAPEIVIKVEKLDPELDS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgttttccgacctgtttcccatccttccgggtggtgggagagaagcagctcccg
caggagattattttcctggtctggtcgcccaagcgggatctcattgctttggccaacaca
gctggcgaggttttacttcatcgactggcaagttttcatcgagtttggagttttccacca
aatgaaaatacaggaaaggaggtgacgtgtctggcatggagaccagatggcaaacttttg
gcctttgctcttgctgataccaagaaaattgttttgtgtgatgtagaaaaacctgagagc
ttacactctttttctgtggaggctccagtttcctgtatgcattggatggaagtgacagta
gaaagcagtgttctcacatcattttataatgctgaggatgaatcaaatcttctcttacct
aaactacctacactgccaaaaaactatagcaacacctcaaaaatatttagtgaagaaaat
tctgatgaaattattaagctcttgggagacgtcaggcttaatattctcgtccttggagga
agctctggatttattgagctttatgcttatggaatgtttaaaattgctcgagtcacaggg
attgctggtacttgtcttgcattatgtttatcaagtgatttgaaatcattatcagtggtc
acagaagtctctaccaatggtgcttcagaagtttcatactttcagcttgaaactaatctg
ttgtactctttcttacctgaagtaactcggatggccagaaagtttactcatatttcagct
ctgttacagtatataaatttgtcactaacatgtatgtgtgaagcatgggaagaaatacta
atgcagatggattctcgtctcaccaagtttgtgcaggaaaagaacacaaccacatcagtg
caagatgagttcatgcacttgctattatgggggaaagcaagtgctgaacttcagactctc
ttgatgaatcagttaacagtaaagggcttgaaaaagcttggccagtctatagagtcatca
tactccagtatacaaaaattggtcataagtcatttacagagtggctcggagtctttatta
taccatttgagtgaattgaaaggaatggcttcatggaagcaaaaatatgaacctcttgga
ctagatgctgcaggaatcgaagaagctataactgctgtgggttcttttatactcaaggca
aatgaacttcttcaagttatagatagtagtatgaaaaacttcaaagcattttttcggtgg
ctttatgtggcaatgttgagaatgacagaagaccatgtgcttcccgagctgaataagatg
actcagaaagatatcacatttgttgctgaatttcttactgaacatttcaatgaggctcca
gacctttataatcgaaaaggaaaatactttaacgttgaaagagttggtcagtacttgaaa
gatgaagatgatgatcttgtgtcaccccctaacacagaaggaaaccagtggtatgacttt
cttcaaaatagcagccaccttaaagaaagtcctttgctgtttccttattatcctcgaaaa
tcattgcattttgtgaaaaggcggatggagaatattattgatcagtgtttgcaaaagcca
gcagatgtaattggaaaatcgatgaatcaagcaatctgtattccattgtatagagatacc
agaagtgaggattctacacgtagattgttcaaatttccttttctgtggaataataaaact
tcaaatctacattatcttctttttactattctagaagattcactttataaaatgtgcatc
ttaaggagacatactgatatttctcaatctgtgagtaatggactaattgctattaaattt
gggagctttacatatgccacaacagaaaaagtcagaagaagcatctacagttgtttagat
gcacagttttatgatgatgaaactgtaacagtagttcttaaagacactgtaggacgtgaa
ggaagagatagactcttggtccagctgcctttgtctttagtatataacagtgaagattct
gcagaatatcagttcactgggacttattctacaaggctagatgaacagtgtagtgctatt
cccacccgtaccatgcattttgagaagcactggagattactggaaagtatgaaagcacag
tatgttgctgggaatggttttcgaaaagtgtcctgtgtgttaagctcaaatcttcgtcat
gtgagagtatttgaaatggacatagatgatgaatgggagctcgatgagtcttcagatgaa
gaggaggaggccagtaataagcctgtaaaaataaaggaagaagtgttgtcggagtcagag
gcagagaaccaacaagctggtgctgccgctttagctccagagatagtcattaaagtggaa
aaacttgaccctgagctagactcctaa

KEGG   Homo sapiens (human): 51433Help
Entry
51433             CDS       T01001                                 

Gene name
ANAPC5, APC5
Definition
(RefSeq) anaphase promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04657  IL-17 signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51433 (ANAPC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51433 (ANAPC5)
   04114 Oocyte meiosis
    51433 (ANAPC5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    51433 (ANAPC5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51433 (ANAPC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51433 (ANAPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51433 (ANAPC5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51433 (ANAPC5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     51433 (ANAPC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    51433 (ANAPC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC5 TPR_12 TPR_10 TPR_2 TPR_7 VP4_haemagglut MapZ_EC1 TPR_19
Motif
Other DBs
NCBI-GeneID: 51433
NCBI-ProteinID: NP_057321
OMIM: 606948
HGNC: 15713
Ensembl: ENSG00000089053
Vega: OTTHUMG00000169157
Pharos: Q9UJX4(Tbio)
UniProt: Q9UJX4
LinkDB All DBs
Structure
PDB: 

Position
12q24.31
AA seq 755 aa AA seqDB search
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSR
DEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNS
IEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIA
LPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDK
GRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgtccacgagagcctctacttcaatcccatgatgaccaatggggttgtgcac
gccaatgtgttcggcatcaaggactgggtgacgccgtacaagatcgcggtgctggtgctg
ctgaacgagatgagccgcacaggcgagggcgccgtcagcctcatggagcggcggaggctc
aaccagctgctcctgcccctgctgcagggcccagatattacactgtcaaaactttacaag
ttaattgaagagtcttgtccacagctggcaaattcagtgcagatcagaatcaaactgatg
gctgaaggcgagttgaaggatatggaacagttttttgatgacctttcagattctttctct
ggaactgaaccagaggttcacaaaacaagtgtagtaggtttgtttctgcgtcacatgatc
ttggcctacagtaagctttctttcagccaagtgtttaaactgtacactgcccttcagcag
tacttccagaatggtgagaaaaagacagtggaggatgctgatatggaactgaccagtaga
gatgagggtgaaagaaaaatggaaaaagaagaacttgatgtatctgtaagagaagaggag
gtatcttgcagtgggcctctgtcccaaaaacaagcagaattttttctttctcaacaggct
tctttgctaaagaatgatgagactaaggccctcactccagcttccttgcagaaggaatta
aacaatttgttgaaatttaatcctgattttgctgaagcgcattatctcagctacttaaac
aacctccgtgtccaagatgttttcagttcaacacacagtctcctccattattttgatcgt
ctgattcttaccggagccgaaagcaaaagtaatggggaagagggctatggccggagcttg
agatacgccgctctgaatcttgccgccctgcactgccgcttcggtcactatcaacaggca
gagctcgccctgcaggaggcaattaggattgcccaggagtccaacgatcacgtgtgtctc
cagcactgtttgagctggctttatgtgctggggcagaagagatccgatagctatgttctg
ctggagcattctgtgaagaaggcagtacattttgggttaccgtacctcgcctccctggga
atacagtcccttgttcaacagagagcttttgctgggaagacggcaaacaagctgatggat
gccctaaaggactccgacctcctgcactggaaacacagcctgtcagagctcatcgatatc
agcatcgcacagaaaacggccatctggaggctgtatggccgcagcaccatggcactgcaa
caggcccagatgttgctgagcatgaacagcctggaggcggtgaatgcgggcgtgcagcag
aacaacacagagtcctttgctgtcgcactctgccacctcgcagagctacacgcggagcag
ggctgttttgctgcagcttctgaagtgttaaagcacttgaaggaacgatttccgcctaat
agtcagcacgcccagttatggatgctatgtgatcaaaaaatacagtttgacagagcaatg
aatgatggcaaatatcatttggctgattcacttgttacaggaatcacagctctcaatagc
atagagggtgtttataggaaagcggttgtattacaagctcagaaccaaatgtcagaggca
cataagcttttacaaaaattgttggttcattgtcagaaactgaagaacacagaaatggtg
atcagtgtcctactgtccgtggcagagctgtactggcgatcttcctcccctaccatcgcg
ctgcccatgctcctgcaggctctggccctctccaaggagtaccggttacagtacttggcc
tctgaaacagtgctgaacttggcttttgcgcagctcattcttggaatcccagaacaggcc
ttaagtcttctccacatggccatcgagcccatcttggctgacggggctatcctggacaaa
ggtcgtgccatgttcttagtggccaagtgccaggtggcttcagcagcttcctacgatcag
ccgaagaaagcagaagctctggaggctgccatcgagaacctcaatgaagccaagaactat
tttgcaaaggttgactgcaaagagcgcatcagggacgtcgtttacttccaggccagactc
taccataccctggggaagacccaggagaggaaccggtgtgcgatgctcttccggcagctg
catcaggagctgccctctcatggggtacccttgataaaccatctctag

KEGG   Homo sapiens (human): 51434Help
Entry
51434             CDS       T01001                                 

Gene name
ANAPC7, APC7
Definition
(RefSeq) anaphase promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51434 (ANAPC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51434 (ANAPC7)
   04114 Oocyte meiosis
    51434 (ANAPC7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51434 (ANAPC7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51434 (ANAPC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51434 (ANAPC7)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51434 (ANAPC7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     51434 (ANAPC7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    51434 (ANAPC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_14 TPR_8 TPR_1 TPR_16 TPR_19 ANAPC3 TPR_7 TPR_11 TPR_12 ChAPs TPR_17 TPR_21 TPR_10 BTAD
Motif
Other DBs
NCBI-GeneID: 51434
NCBI-ProteinID: NP_057322
OMIM: 606949
HGNC: 17380
Ensembl: ENSG00000196510
Vega: OTTHUMG00000157009
Pharos: Q9UJX3(Tbio)
UniProt: Q9UJX3 Q4KMX6 A0A024RBJ3 Q69YV3
LinkDB All DBs
Structure
PDB: 

Position
12q24.11
AA seq 599 aa AA seqDB search
MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLL
LTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPST
GNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYK
KAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWI
KAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQML
DPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALY
LGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLAS
NSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVV
KKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDP
NDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggaccccggcgacgccgccattttggagtcttccctaaggatcctctaccggcttttc
gagtcagtgctgccgccgctgcccgcggctttgcagagcaggatgaatgtgatagaccac
gtgcgggacatggcggccgcggggctgcactccaacgtgcggctcctcagcagcttgtta
cttacaatgagtaataacaaccctgagttattctccccacctcagaagtaccagcttttg
gtgtatcatgcagattctctctttcatgataaggaatatcggaatgctgtgagtaagtat
accatggctttacagcagaagaaagcgctaagtaaaacttcaaaagtgagaccttcaact
ggaaattctgcatctactccacaaagtcagtgtcttccatctgaaattgaagtgaaatac
aaaatggctgaatgttatacaatgctaaaacaagataaagatgccattgctatacttgat
gggatcccttcaagacaaagaactcccaaaataaacatgatgctggcaaacctgtacaag
aaggctggtcaggagcgcccttcagtcaccagctataaggaggtgctgaggcagtgccca
ttagcccttgatgccattctaggcttgttgtccctttctgtaaaaggggcagaggtggca
tccatgacaatgaatgtgatccaaaccgtgcctaacttggactggctctctgtgtggatc
aaagcgtatgcttttgtgcacactggtgacaactcaagagcaatcagtaccatctgttca
ctagagaaaaaatccttattgcgagataacgtggacctattgggaagcttggcagatctg
tacttcagagctggagacaataaaaactctgtcctcaagtttgaacaggcacagatgttg
gatccttatctgataaaaggaatggatgtatatggctacctactggcacgagaagggcgg
ctagaggatgttgagaaccttggatgccgccttttcaatatctctgatcagcatgcagaa
ccgtgggtggtttctggctgtcacagcttctatagcaaacgctactcccgggccctctat
ttaggagccaaggccattcagctgaacagtaatagtgttcaagctctgctacttaaggga
gcagcacttaggaacatgggcagagtccaagaagcaataatccactttcgggaggccata
cggctcgcaccttgtcgcttagattgttatgaaggtcttatcgaatgttacttagcctcc
aacagtattcgagaagcaatggtaatggctaacaacgtttacaaaactctgggagcaaat
gcacagacccttacccttttagccaccgtttgtcttgaagacccagtgacacaggagaaa
gccaaaacattattagataaagccctgacccaaaggccagattacattaaggctgtggtg
aaaaaagcagaactacttagcagagaacagaaatatgaagatggaattgctttgctgagg
aacgcactggctaatcagagtgactgtgtcctgcatcggatcctaggagatttccttgta
gctgtcaatgagtatcaggaggcaatggaccagtatagtatagcactaagtttggacccc
aatgaccagaagtctctagaggggatgcagaagatggagaaggaggagagtcccacggat
gccactcaggaggaggatgtggacgacatggaagggagtggggaagaaggggacctggag
ggcagcgacagtgaggcggcccagtgggctgaccaggagcagtggttcggcatgcagtga

KEGG   Homo sapiens (human): 51529Help
Entry
51529             CDS       T01001                                 

Gene name
ANAPC11, APC11, Apc11p, HSPC214
Definition
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51529 (ANAPC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51529 (ANAPC11)
   04114 Oocyte meiosis
    51529 (ANAPC11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51529 (ANAPC11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51529 (ANAPC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51529 (ANAPC11)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51529 (ANAPC11)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     51529 (ANAPC11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    51529 (ANAPC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 51529
NCBI-ProteinID: NP_001002245
OMIM: 614534
HGNC: 14452
Ensembl: ENSG00000141552
Vega: OTTHUMG00000177982
Pharos: Q9NYG5(Tbio)
UniProt: Q9NYG5
LinkDB All DBs
Structure
PDB: 

Position
17q25.3
AA seq 84 aa AA seqDB search
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLHAQQVQQHCPMCRQEWKFKE
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaagattaagtgctggaacggcgtggccacttggctctgggtggccaacgat
gagaactgtggcatctgcaggatggcatttaacggatgctgccctgactgcaaggtgccc
ggcgacgactgcccgctggtgtggggccagtgctcccactgcttccacatgcattgcatc
ctcaagtggctgcacgcacagcaggtgcagcagcactgccccatgtgccgccaggaatgg
aagttcaaggagtga

KEGG   Homo sapiens (human): 64682Help
Entry
64682             CDS       T01001                                 

Gene name
ANAPC1, APC1, MCPR, TSG24
Definition
(RefSeq) anaphase promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64682 (ANAPC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    64682 (ANAPC1)
   04114 Oocyte meiosis
    64682 (ANAPC1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    64682 (ANAPC1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64682 (ANAPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    64682 (ANAPC1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    64682 (ANAPC1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     64682 (ANAPC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    64682 (ANAPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APC1_C ANAPC1 PC_rep
Motif
Other DBs
NCBI-GeneID: 64682
NCBI-ProteinID: NP_073153
OMIM: 608473
HGNC: 19988
Ensembl: ENSG00000153107
Vega: OTTHUMG00000131277
Pharos: Q9H1A4(Tbio)
UniProt: Q9H1A4
LinkDB All DBs
Structure
PDB: 

Position
2q13
AA seq 1944 aa AA seqDB search
MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
SPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCINMHSIEGKDYIASLPFQVANV
WPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSS
LTAHLRSLSKGDSPVTSPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPETEPIVPELCIDHLWTETITNI
REKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKP
LSKLLGSLDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELS
NGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLF
VTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMG
EGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSE
PPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESLVSDESSQYLTRIT
IAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMN
HEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS
APNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISA
FTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRL
GRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWL
QVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
NT seq 5835 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacttctatgaagaaaggacaacgatgattgcagcaagggatttgcaggaattt
gttccttttggtcgagaccactgcaagcaccaccctaatgctttgaaccttcaacttcgc
cagctgcagccagcttctgaattatggtcttctgatggtgctgctggcttggtgggatcc
cttcaggaggttacaatccacgagaaacagaaggaaagctggcagttaaggaaaggagta
agtgaaattggagaagatgtggactatgatgaggaactctatgttgctggaaatatggtg
atatggagcaaaggaagtaaaagccaggcattggcagtttataaagcatttacagttgac
agtcctgttcagcaggcattgtggtgtgacttcattatatcacaggataagtctgaaaag
gcctacagtagcaatgaagtagaaaaatgcatatgtatattgcaaagctcatgtattaac
atgcatagcatagaaggaaaggattacatagcttcattaccatttcaggttgcaaatgtt
tggcccactaaatatggattgctgtttgaacgaagcgcttcttcacatgaagtacctcca
ggttcacccagagaacctttacctactatgttcagcatgctgcacccactagatgaaata
actccacttgtttgtaaatctggaagtctttttggttcatcacgggtgcaatatgttgta
gatcatgcaatgaaaattgttttcctcaatactgacccctctattgtaatgacttatgat
gctgttcaaaatgtgcattctgtgtggactctccggagagtcaaatcagaggaagagaat
gttgttttaaagttctctgaacaggggggaaccccacagaatgtggccactagcagctcc
ctcacagcacatctcagaagcctctccaaaggagattcccctgtgacttcacctttccag
aattactcctccattcacagccagagtcgctcaacctcatcacccagtctacattctcgc
tcaccttctatttccaacatggcagctctaagtcgtgctcattctcctgcgttaggagtg
cactctttttcaggggtgcaaaggttcaacatttcaagccataatcagtctccaaagaga
catagtatttctcattctccaaatagtaattctaatggctcctttcttgcaccagaaacg
gagccaattgttcctgaactgtgtattgaccatttgtggacagaaacgattactaatata
agagagaaaaattcacaagcctcaaaagtgtttattacatctgacctatgtgggcaaaag
ttcctgtgctttttagtagagtcccagctccagttacgctgtgtaaagtttcaagagagt
aatgataaaacccagctcatctttggttcagtgaccaacataccagcaaaggatgcagca
ccagtggagaaaatagacaccatgctggtcttggaaggcagtggaaacctggtgctatac
acaggagtggttcgggtgggaaaggtttttattcctggactgccagctccctctctgacg
atgtccaacacaatgcctcggcccagtactccactagatggcgttagtactccaaagcct
cttagtaaactccttggatcattggacgaggttgttctgttgtccccagttccagaactg
agggattcttcaaaacttcatgattctctctataatgaggattgtactttccaacagctt
ggaacttacattcattctatcagagatcctgtccataacagagtcaccctggaactgagt
aatggctccatggttaggatcactattcctgaaattgccacctctgagttagtacaaacg
tgtttgcaagcaattaagtttatcctgccaaaagaaatagcagttcagatgcttgtcaag
tggtacaatgtccacagtgctccaggaggacccagttatcactcagagtggaatttattt
gtgacttgtctcatgaacatgatgggttataacacagaccgcttagcatggactagaaat
tttgactttgaaggatcactttctcctgtcattgcgcccaaaaaagcaaggccttccgag
actggatctgatgatgactgggaatatttactaaattcagactaccaccagaatgttgag
tctcatcttttgaacagatctttatgtctgagtccttcagaagcttcacagatgaaggat
gaggatttttcacagaatctcagtctggattcttctacacttctctttactcacatacct
gcaatttttttcgttcttcaccttgtgtatgaggagcttaagttgaatactctaatggga
gaaggaatttgttcacttgttgaacttctcgttcagttggcaagggacttaaaattgggg
ccttatgtagatcattactatagagactacccaacgcttgtcagaactactggacaagtg
tgcacaattgatccaggtcaaacaggatttatgcatcatccatcattttttacgtctgag
ccaccaagtatttatcagtgggtgagttcttgtctgaagggtgaaggaatgccaccttat
ccttacctccctggaatctgtgaaagaagcagacttgtagtcttgagtattgcactgtac
atacttggtgatgagagcttggtttctgatgaatcctcacagtatttaaccagaataact
atagccccccagaagttgcaagtagaacaagaggaaaacaggtttagtttcaggcattct
acatctgtttctagtctagctgaaagattggttgtctggatgactaatgtaggattcact
ttaagagatttggaaactcttccctttggaattgctcttcccatcagagatgcaatttat
cactgtcgtgagcagcctgcctcagactggccagaagctgtctgtctcttgattggacgt
caggatctttccaagcaggcctgcgaaggaaacttacccaaagggaagtctgtgctctca
tcagatgttccttcaggaacagaaactgaggaggaagatgacggcatgaatgacatgaat
cacgaggtcatgtcattaatatggagtgaagatttaagggtgcaggatgtgcgaaggctt
cttcagagtgcgcatcctgtccgtgtcaacgtagtgcagtacccagagctcagtgaccac
gagttcatcgaggaaaaggaaaacagattgctccaattgtgtcagcgaactatggctctt
cctgtaggacgaggaatgtttaccttgttttcgtaccatcctgttccaacagagccattg
cctattcctaaattgaatctgactgggcgtgcccctcctcggaacacaacagtagacctt
aatagtggaaacatcgatgtgcctcccaacatgacaagctgggccagctttcataatggt
gtggctgctggcctgaagatagctcctgcctcccagatcgactcagcttggattgtttac
aataagcccaagcatgctgagttggccaatgagtatgctggctttctcatggctctgggt
ttgaatgggcaccttaccaagctggcgactctcaatatccatgactacttgaccaagggc
catgaaatgacaagcattggactgctacttggtgtttctgctgcaaaactaggcaccatg
gatatgtctattactcggcttcttagcattcacattcctgctctcttacccccaacgtcc
acagagctggatgttcctcacaatgtccaagtggctgcagtggttggcattggccttgta
tatcaagggacagctcacagacatactgcagaagtcctgttggctgagataggacggcct
cctggtcctgaaatggaatactgcactgacagagagtcatactccttagctgctggcttg
gccctgggcatggtctgcttggggcatggcagcaatttgataggtatgtctgatctcaat
gtgcctgagcagctctatcagtacatggttggaggacataggcgctttcaaacaggaatg
catagggagaaacataaatcaccaagttatcaaatcaaagaaggagataccataaatgtg
gatgtgacttgtccaggtgctactctagctttggctatgatctacttaaaaaccaataac
agatctattgcagattggctccgagcccctgacaccatgtatttgttggactttgtgaag
ccagaatttctcttgcttaggacacttgctcgatgcctgattttgtgggatgatatttta
ccaaattccaagtgggttgacagcaatgttcctcaaattataagagaaaatagtatctct
ctcagtgaaatcgaattgccgtgctcagaggatttgaatttggaaactttgtcccaagca
catgtctacataattgcaggagcctgcttgtctctgggttttcgatttgctggctcagaa
aacttatcagcatttaactgtttgcataaatttgccaaagattttatgacttatttgtcc
gcacctaatgcttctgttacaggtcctcataacctagaaacttgtctgagcgtggtgctg
ctgtctctcgccatggtcatggctggctcaggaaacctaaaggttttgcagctttgtcgc
ttcttacacatgaaaacgggtggtgaaatgaactatggttttcacttagcccaccacatg
gcccttggacttctatttttgggaggaggaaggtactctttgagcacatcaaattcttcc
attgccgctcttctctgtgccctttatccgcacttcccagctcacagcactgacaaccgg
tatcatctccaggctctccggcacctctatgtgctggccgcggagcccaggcttctagtg
cctgtggatgtggacacaaacacgccctgctatgccctcttagaagttacctacaagggc
actcagtggtatgaacaaaccaaagaagaattgatggctcctacccttcttccagaactc
catcttttaaagcagattaaagtaaaaggcccaagatactgggaactgctcatagattta
agcaaaggaacacaacacttgaagtccatcctttccaaggatggggttttatatgttaaa
ctccgggcgggtcagctctcctacaaagaagatccaatgggatggcaaagtttgttggct
cagactgttgctaacaggaactctgaagcccgggctttcaagccagaaacaatctcagca
ttcacttctgatccagcacttctgtcatttgctgaatatttctgcaagccaactgtgaac
atgggtcagaaacaggaaattctggatctcttttcttcagtactctatgaatgtgttacc
caggagaccccagagatgttgcctgcatacatcgcaatggatcaggctataagaagactt
gggagaagagaaatgtctgagacttctgaactttggcagataaagttggtgttagagttt
ttcagctcccgaagccatcaggagcggctgcagaaccaccctaagcgggggctctttatg
aactcggaattcctccctgttgtgaagtgcaccattgataataccctggaccagtggcta
caagtcgggggtgatatgtgtgtgcacgcctacctcagcgggcagcccttggaggaatca
cagctgagcatgctggcctgcttcctcgtctaccactctgtgccagctccacagcacctg
ccacctataggactagaagggagcacaagctttgctgaactgctcttcaaatttaagcag
ctaaaaatgccagtgcgagctttgctgagattggctcctttgcttcttggaaatccacag
ccaatggtgatgtga

KEGG   Homo sapiens (human): 8697Help
Entry
8697              CDS       T01001                                 

Gene name
CDC23, ANAPC8, APC8, CUT23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8697 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8697 (CDC23)
   04114 Oocyte meiosis
    8697 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8697 (CDC23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8697 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8697 (CDC23)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8697 (CDC23)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     8697 (CDC23)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    8697 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 ANAPC3 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 8697
NCBI-ProteinID: NP_004652
OMIM: 603462
HGNC: 1724
Ensembl: ENSG00000094880
Vega: OTTHUMG00000129198
Pharos: Q9UJX2(Tbio)
UniProt: Q9UJX2
LinkDB All DBs
Structure
PDB: 

Position
5q31.2
AA seq 597 aa AA seqDB search
MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagtacctccatggtcccggtggctgtgacggcggcagtggcgcctgtcctg
tccataaacagcgatttctcagatttgcgggaaattaaaaagcaactgctgcttattgcg
ggccttacccgggagcggggcctactacacagtagcaaatggtcggcggagttggctttc
tctctccctgcattgcctctggccgagctgcaaccgcctccgcctattacagaggaagat
gcccaggatatggatgcctataccctggccaaggcctactttgacgttaaagagtatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctattttctgtatatgtat
tccagatatctgtctggagaaaaaaagaaggacgatgaaacagttgatagcttaggcccc
ctggaaaaaggacaagtgaaaaatgaggcgcttagagaattgagagtggagctcagcaaa
aaacaccaagctcgagaacttgatggatttggactttatctgtatggtgtggtgcttcga
aaactggacttggttaaagaggccattgatgtgtttgtggaagctactcatgttttgccc
ttgcattggggagcctggttagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcgtatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctccatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatcggagttgagttatctggct
cataacctctgtgagattgataaatatcgtgtagaaacgtgctgtgtaattggcaattat
tacagtttacgttctcagcatgagaaagcagccttatatttccagagagccctgaaatta
aatcctcggtatcttggtgcctggacactaatgggacatgagtacatggagatgaagaac
acgtctgctgctatccaggcttatagacatgccattgaggtcaacaaacgggactacaga
gcttggtatggcctcgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgggcccaccagcttcgacccaatgattctcgcatgctggttgctttagga
gaatgttacgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtagaacacttggaggaaagcactgcctttcgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcacaaaagtgttgtgcatttaat
gatacccgggaagaaggtaaggccttactccggcaaatcctacagcttcggaaccaaggc
gagactcctaccaccgaggtgcctgctccctttttcctacctgcttcactctctgctaac
aatacccccacacgcagagtttctccactcaacttgtcttctgtcacgccatag

KEGG   Homo sapiens (human): 8881Help
Entry
8881              CDS       T01001                                 

Gene name
CDC16, ANAPC6, APC6, CDC16Hs, CUT9
Definition
(RefSeq) cell division cycle 16
  KO
K03353  anaphase-promoting complex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8881 (CDC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8881 (CDC16)
   04114 Oocyte meiosis
    8881 (CDC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8881 (CDC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8881 (CDC16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8881 (CDC16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8881 (CDC16)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8881 (CDC16)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     8881 (CDC16)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     8881 (CDC16)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    8881 (CDC16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_8 TPR_7 TPR_10 TPR_19 TPR_11 TPR_9 TPR_16 SRP_TPR_like Dynein_light
Motif
Other DBs
NCBI-GeneID: 8881
NCBI-ProteinID: NP_001072113
OMIM: 603461
HGNC: 1720
Ensembl: ENSG00000130177
Vega: OTTHUMG00000017402
Pharos: Q13042(Tbio)
UniProt: Q13042 A0A024RDZ2
LinkDB All DBs
Structure
PDB: 

Position
13q34
AA seq 620 aa AA seqDB search
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagagcggctgcggaagcgcgtccggcagtacctcgaccagcaacagtatcaa
agtgctctattttgggcagataaagtagcttcactctctcgtgaagaaccccaggacatc
tattggttggctcagtgtctttacctgacagcacaatatcacagagccgcccatgcactt
cggtcacgaaaactggacaaattgtatgaagcatgtcgttaccttgcagctaggtgccat
tatgctgcaaaagagcaccagcaggcccttgatgttcttgacatggaagagcccatcaat
aaaagattatttgaaaaatacttgaaggacgaaagtggcttcaaagatccttccagcgac
tgggaaatgtcacagtcttcaataaagagttctatctgtcttctacgcgggaaaatctat
gatgctctagataaccgaaccctggctacctacagctacaaagaagctttgaagcttgat
gtctactgttttgaagcgttcgatcttttaacatcacatcacatgctgacagcacaagaa
gaaaaagaacttcttgaatcactaccccttagcaagctgtgtaatgaagaacaggaattg
ctgcgttttctatttgagaacaaattgaaaaaatataataagcctagtgaaacggtcatc
cctgaatctgtagatggcttgcaagagaatctggatgtggtagtgtctttagctgagaga
cattattataactgtgattttaaaatgtgctacaagcttacttctgtagtaatggagaaa
gatcctttccatgcaagttgtttacctgtacatatagggacgcttgtagagctgaataaa
gccaatgaacttttctatctttctcataaactggtggatttatatcctagtaatcctgtg
tcttggtttgcagtgggatgttactatctcatggtcggtcataaaaatgaacatgccaga
agatatctcagcaaagccacaacacttgagaaaacctatggacctgcatggatagcctat
ggacattcatttgcggtggagagtgagcacgaccaagcgatggctgcttacttcacagca
gcacagctgatgaaagggtgtcatttgcctatgctgtatattggattagaatatggtttg
accaataactcaaaactagctgaaaggttcttcagccaagctctgagcattgcaccggaa
gacccttttgttatgcatgaggtcggcgtggttgcatttcagaatggagaatggaaaaca
gccgaaaaatggtttcttgatgctttggaaaaaattaaagcaattgggaacgaggtaaca
gttgacaaatgggaacctttgttgaacaacttggggcatgtctgcagaaaacttaaaaag
tatgctgaggccttggattaccaccgtcaggcactggtgttgattcctcagaacgcatcc
acctactctgctattggatatatccacagtctgatgggcaactttgaaaatgctgtggac
tacttccacacagcccttggtcttaggcgagatgatacattttctgttacaatgcttggt
cattgcatcgaaatgtacattggtgattctgaagcttatattggagcagacattaaagac
aaattaaaatgttatgactttgatgtgcatacaatgaagacactaaaaaacattatttca
cctccgtgggatttcagggaatttgaagtagaaaaacagactgcagaagaaacggggctt
acgccattggaaacctcaaggaaaactccagattccagaccttccttggaagaaaccttt
gaaattgaaatgaatgaaagtgacatgatgttagagacatctatgtcagaccacagcacg
tga

KEGG   Homo sapiens (human): 996Help
Entry
996               CDS       T01001                                 

Gene name
CDC27, ANAPC3, APC3, CDC27Hs, D0S1430E, D17S978E, H-NUC, HNUC, NUC2
Definition
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    996 (CDC27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    996 (CDC27)
   04114 Oocyte meiosis
    996 (CDC27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    996 (CDC27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    996 (CDC27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    996 (CDC27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    996 (CDC27)
   03036 Chromosome and associated proteins [BR:hsa03036]
    996 (CDC27)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     996 (CDC27)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     996 (CDC27)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    996 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_17 TPR_19 TPR_16 TPR_14 TPR_6 TPR_9 ChAPs TPR_MalT TPR_20 TPR_21 Cas_Cas02710
Motif
Other DBs
NCBI-GeneID: 996
NCBI-ProteinID: NP_001247
OMIM: 116946
HGNC: 1728
Ensembl: ENSG00000004897
Vega: OTTHUMG00000166429
Pharos: P30260(Tbio)
UniProt: P30260
LinkDB All DBs
Structure
PDB: 

Position
17q21.32
AA seq 824 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTP
QVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ
PNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcggttttcctcgcagaacgcctttatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcaatgcaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattcacatctttacagaactttagcaactgtctg
cccaactcttgcacaacacaagtacctaatcatagtttatctcacagacagcctgagaca
gttcttacggaaacaccccaggacacaattgaattaaacagattgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatt
tcacctgatactgtcccactgggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccagcagctcttagtccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacacctcctgtaattgatgtgccatccaccggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcacagagtggaaatagccga
gaggtaactccaattcttgcacaaacacaaagttctggtccacaaacaagtacaacacct
caggtattgagccccactattacatctcccccaaacgcactgcctcgaagaagttcacga
ctctttactagtgacagctccacaaccaaggagaatagcaaaaaattaaaaatgaagttt
ccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataactcaa
cctaacataaatgatagcctggaaattacaaaattggactcttccatcatttcagaaggg
aaaatatccacaatcacacctcagattcaggcctttaatctacaaaaagcagcagcagaa
ggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcatacaac
tgcaaagaagctataaatattttgagccatctaccttctcaccactacaatactggttgg
gtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaaaga
atattctcagaggttagaaggattgagaattatagagttgaaggcatggagatctactct
acaacactttggcatcttcaaaaagatgttgctctttcagttctgtcaaaagacttaaca
gacatggataaaaattcgccagaggcctggtgtgctgcagggaactgtttcagtctgcaa
cgggaacatgatattgcaattaaattcttccagagagctatccaagttgatccaaattac
gcttatgcctatactctattagggcatgagtttgtcttaactgaagaattggacaaagca
ttagcttgttttcgaaatgctatcagagtcaatcctagacattataatgcatggtatggt
ttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccaaaaa
gcgcttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcaacat
gcactgaaaaaatcagagaaggctttggataccctaaacaaagccattgtcattgatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatataag
tctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtttac
ttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaattgat
aagcgttatcttccagatgatgaggagccaataacccaagaagaacagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcggatgacacacaacttcatgcagctgaa
agtgatgaattttaa

DBGET integrated database retrieval system