KEGG   Homo sapiens (human): 10398Help
Entry
10398             CDS       T01001                                 

Gene name
MYL9, LC20, MLC-2C, MLC2, MRLC1, MYRL2
Definition
(RefSeq) myosin light chain 9
  KO
K12755  myosin regulatory light chain 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10398 (MYL9)
   04022 cGMP-PKG signaling pathway
    10398 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10398 (MYL9)
   04530 Tight junction
    10398 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10398 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    10398 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    10398 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10398 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    10398 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10398 (MYL9)
   04147 Exosome [BR:hsa04147]
    10398 (MYL9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10398 (MYL9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   10398 (MYL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH Syntaxin SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 10398
NCBI-ProteinID: NP_006088
OMIM: 609905
HGNC: 15754
Ensembl: ENSG00000101335
Vega: OTTHUMG00000032387
Pharos: P24844(Tbio)
UniProt: P24844 A0A384NY64
LinkDB All DBs
Position
20q11.23
AA seq 172 aa AA seqDB search
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagcgggccaaagccaagaccaccaagaagcggccacagcgggccacatcc
aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggctttcaacatg
attgaccagaaccgtgatggcttcattgacaaggaggacctgcacgacatgctggcctcg
ctggggaagaaccccacagacgaatacctggagggcatgatgagcgaggccccggggccc
atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacggaccccgag
gatgtgattcgcaacgcctttgcctgcttcgacgaggaagcctcaggtttcatccatgag
gaccacctccgggagctgctcaccaccatgggtgaccgcttcacagatgaggaagtggac
gagatgtaccgggaggcacccattgataagaaaggcaacttcaactacgtggagttcacc
cgcatcctcaaacatggcgccaaggataaagacgactag

DBGET integrated database retrieval system