KEGG   Homo sapiens (human): 10398
Entry
10398             CDS       T01001                                 

Gene name
MYL9, LC20, MLC-2C, MLC2, MRLC1, MYRL2
Definition
(RefSeq) myosin light chain 9
  KO
K12755  myosin regulatory light chain 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa05131  Shigellosis
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01074  Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway
N01130  Salmonella SopB to RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10398 (MYL9)
   04022 cGMP-PKG signaling pathway
    10398 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10398 (MYL9)
   04530 Tight junction
    10398 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10398 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    10398 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    10398 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10398 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    10398 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10398 (MYL9)
   05131 Shigellosis
    10398 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10398 (MYL9)
   04147 Exosome [BR:hsa04147]
    10398 (MYL9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10398 (MYL9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   10398 (MYL9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 10398
NCBI-ProteinID: NP_006088
OMIM: 609905
HGNC: 15754
Ensembl: ENSG00000101335
Vega: OTTHUMG00000032387
Pharos: P24844(Tbio)
UniProt: P24844 A0A384NY64
LinkDB
Position
20q11.23
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagcgggccaaagccaagaccaccaagaagcggccacagcgggccacatcc
aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggctttcaacatg
attgaccagaaccgtgatggcttcattgacaaggaggacctgcacgacatgctggcctcg
ctggggaagaaccccacagacgaatacctggagggcatgatgagcgaggccccggggccc
atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacggaccccgag
gatgtgattcgcaacgcctttgcctgcttcgacgaggaagcctcaggtttcatccatgag
gaccacctccgggagctgctcaccaccatgggtgaccgcttcacagatgaggaagtggac
gagatgtaccgggaggcacccattgataagaaaggcaacttcaactacgtggagttcacc
cgcatcctcaaacatggcgccaaggataaagacgactag

KEGG   Homo sapiens (human): 140465
Entry
140465            CDS       T01001                                 

Gene name
MYL6B, MLC1SA
Definition
(RefSeq) myosin light chain 6B
  KO
K12751  myosin light chain 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04530  Tight junction
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    140465 (MYL6B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    140465 (MYL6B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    140465 (MYL6B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    140465 (MYL6B)
   04147 Exosome [BR:hsa04147]
    140465 (MYL6B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     140465 (MYL6B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   140465 (MYL6B)
  Exosomal proteins of bladder cancer cells
   140465 (MYL6B)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_9
Other DBs
NCBI-GeneID: 140465
NCBI-ProteinID: NP_001186558
OMIM: 609930
HGNC: 29823
Ensembl: ENSG00000196465
Vega: OTTHUMG00000170199
Pharos: P14649(Tdark)
UniProt: P14649 A0A024RB31
LinkDB
Structure
PDB: 
1OE9 1W7I 1W7J

Position
12q13.2
AA seq 208 aa
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIE
FNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSR
RVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEE
EVETVLAGHEDSNGCINYEAFLKHILSV
NT seq 627 nt   +upstreamnt  +downstreamnt
atgcctcccaagaaggatgttcccgtgaagaaaccagcagggccctccatctccaaacct
gctgctaagccagcagcagcaggggctcctccagccaagaccaaagctgagccagctgtc
ccccaggcccctcagaaaacccaggagcctccagtcgatctctccaaagtggtgatcgag
tttaacaaggaccagctggaggagttcaaggaggccttcgagctgtttgaccgagtgggg
gatggcaagatcctgtacagccagtgtggggacgtgatgagggccctgggccagaacccc
accaacgccgaggtgctcaaggtcctggggaaccccaagagtgatgagctgaagtcgcgg
cgtgtggactttgagactttcctgcccatgctccaggcagtggccaagaaccgaggccaa
ggcacatatgaggactacttggaggggtttcgtgtgtttgacaaggaggggaacggcaaa
gtcatgggagcagagctcagacatgttctcaccacccttggagagaagatgactgaggag
gaggtggagaccgttctggcaggacacgaggacagcaacggctgcatcaactacgaggcc
ttcttgaaacacatcctaagcgtctga

KEGG   Homo sapiens (human): 4637
Entry
4637              CDS       T01001                                 

Gene name
MYL6, ESMLC, LC17, LC17-GI, LC17-NM, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM, MLC3SM
Definition
(RefSeq) myosin light chain 6
  KO
K12751  myosin light chain 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04530  Tight junction
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4637 (MYL6)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4637 (MYL6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4637 (MYL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4637 (MYL6)
   04147 Exosome [BR:hsa04147]
    4637 (MYL6)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4637 (MYL6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4637 (MYL6)
  Exosomal proteins of bladder cancer cells
   4637 (MYL6)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_9 EF-hand_5
Other DBs
NCBI-GeneID: 4637
NCBI-ProteinID: NP_066299
OMIM: 609931
HGNC: 7587
Ensembl: ENSG00000092841
Vega: OTTHUMG00000170200
Pharos: P60660(Tbio)
UniProt: P60660
LinkDB
Position
12q13.2
AA seq 151 aa
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEAFVRHILSG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtgtgacttcaccgaagaccagaccgcagagttcaaggaggccttccagctgtttgac
cgaacaggtgatggcaagatcctgtacagccagtgtggggatgtgatgagggccctgggc
cagaaccctaccaacgccgaggtgctcaaggtcctggggaaccccaagagtgatgagatg
aatgtgaaggtgctggactttgagcactttctgcccatgctgcagacagtggccaagaac
aaggaccagggcacctatgaggattatgtcgaaggacttcgggtgtttgacaaggaagga
aatggcaccgtcatgggtgctgaaatccggcatgttcttgtcacactgggtgagaagatg
acagaggaagaagtagagatgctggtggcagggcatgaggacagcaatggttgtatcaac
tatgaagcgtttgtgaggcatatcctgtcggggtga

DBGET integrated database retrieval system