KEGG   Homo sapiens (human): 10401Help
Entry
10401             CDS       T01001                                 

Gene name
PIAS3, ZMIZ5
Definition
(RefSeq) protein inhibitor of activated STAT 3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10401 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    10401 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10401 (PIAS3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     10401 (PIAS3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   10401 (PIAS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP
Motif
Other DBs
NCBI-GeneID: 10401
NCBI-ProteinID: NP_006090
OMIM: 605987
HGNC: 16861
Ensembl: ENSG00000131788
Vega: OTTHUMG00000013750
Pharos: Q9Y6X2(Tbio)
UniProt: Q9Y6X2 B3KNI3
LinkDB All DBs
Structure
PDB: 

Position
1q21.1
AA seq 628 aa AA seqDB search
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgcttcttggctttgctggccggaacaagagtggacggaagcacgagctcctggccaag
gctctgcacctcctgaagtccagctgtgcccctagtgtccagatgaagatcaaagagctt
taccgacgacgctttccccggaagaccctggggccctctgatctctcccttctctctttg
ccccctggcacctctcctgtaggctcccctggtcctctagctcccattcccccaacgctg
ttggcccctggcaccctgctgggccccaagcgtgaggtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaagtctatggggag
ctcatccggcccaccacccttgcatccacttctagccagcggtttgaggaagcgcacttt
acctttgccctcacaccccagcaagtgcagcagattcttacatccagagaggttctgcca
ggagccaaatgtgattataccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaagattattttccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttcccccaaccaagaatggggccgagcccaagaggcccagccgc
cccatcaacatcacacccctggctcgactctcagccactgttcccaacaccattgtggtc
aattggtcatctgagttcggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcaggaacccttctacaaaaactcagagcaaagggtatccggaacccagaccactcg
cgggcactgatcaaggagaaattgactgctgaccctgacagtgaggtggccactacaagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctgactgtcccttgtcgtgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aagcctacatggacatgtcctgtgtgtgacaagaaggctccctatgaatctcttatcatt
gatggtttatttatggagattcttagttcctgttcagattgtgatgagatccaattcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtacagcccagtccaggggggagatccatcagag
aataagaagaaggtcgaagttattgacttgacaatagaaagctcatcagatgaggaggat
ctgccccctaccaagaagcactgttctgtcacctcagctgccatcccggccctacctgga
agcaaaggagtcctgacatctggccaccagccatcctcggtgctaaggagccctgctatg
ggcacgttgggtggggatttcctgtccagtctcccactacatgagtacccacctgccttc
ccactgggagccgacatccaaggtttagatttattttcatttcttcagacagagagtcag
cactatggcccctctgtcatcacctcactagatgaacaggatgcccttggccacttcttc
cagtaccgagggaccccttctcactttctgggcccactggcccccacgctggggagctcc
cactgcagcgccactccggcgccccctcctggccgtgtcagcagcattgtggcccctggg
ggggccttgagggaggggcatggaggacccctgccctcaggtccctctttgactggctgt
cggtcagacatcatttccctggactga

KEGG   Homo sapiens (human): 51588Help
Entry
51588             CDS       T01001                                 

Gene name
PIAS4, PIAS-gamma, PIASY, Piasg, ZMIZ6
Definition
(RefSeq) protein inhibitor of activated STAT 4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04630  Jak-STAT signaling pathway
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51588 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    51588 (PIAS4)
   04064 NF-kappa B signaling pathway
    51588 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    51588 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51588 (PIAS4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     51588 (PIAS4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   51588 (PIAS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP
Motif
Other DBs
NCBI-GeneID: 51588
NCBI-ProteinID: NP_056981
OMIM: 605989
HGNC: 17002
Ensembl: ENSG00000105229
Vega: OTTHUMG00000181759
Pharos: Q8N2W9(Tbio)
UniProt: Q8N2W9 B3KMR4
LinkDB All DBs
Position
19p13.3
AA seq 510 aa AA seqDB search
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA
ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEE
EEEEEEEDEDEEGPRPKRRCPFQKGLVPAC
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagttttcgagtctccgacctt
cagatgctcctgggtttcgtgggccggagtaagagtggactgaagcacgagctcgtcacc
agggccctccagctggtgcagtttgactgtagccctgagctgttcaagaagatcaaggag
ctgtacgagacccgctacgccaagaagaactcggagcctgccccacagccgcaccggccc
ctggaccccctgaccatgcactccacctacgaccgggccggcgctgtgcccaggactccg
ctggcaggccccaatattgactaccccgtgctctacggaaagtacttaaacggactggga
cggttgcccgccaagaccctcaagccagaagtccgcctggtgaagctgccgttctttaat
atgctggatgagctgctgaagcccaccgaattagtcccacagaacaacgagaagcttcag
gagagcccgtgcatcttcgcattgacgccaagacaggtggagttgatccggaactccagg
gaactgcagcccggagttaaagccgtgcaggtcgtcctgagaatctgttactcagacacc
agctgccctcaggaggaccagtacccgcccaacatcgctgtgaaggtcaaccacagctac
tgctccgtcccgggctactacccctccaataagcccggggtggagcccaagaggccgtgc
cgccccatcaacctcacccacctcatgtacctgtcctcggccaccaaccgcatcactgtc
acctgggggaactacggcaagagctactcggtggccctgtacctggtgcggcagctgacc
tcatcggagctgctgcagaggctgaagaccattggggtaaagcacccggagctgtgcaag
gcactggtcaaggagaagctgcgccttgatcctgacagcgagatcgccaccaccggtgtg
cgggtgtccctcatctgtccgctggtgaagatgcggctctccgtgccctgccgggcagag
acctgtgcccacctgcagtgcttcgacgccgtcttctacctgcagatgaacgagaagaag
cccacctggatgtgccccgtgtgcgacaagccagccccctacgaccagctcatcatcgac
gggctcctctcgaagatcctgagcgagtgtgaggacgccgacgagatcgagtacctggtg
gacggctcgtggtgcccgatccgcgccgaaaaggagcgcagctgcagcccgcagggcgcc
atcctcgtgctgggcccctcggacgccaatgggctcctgcccgcccccagcgtcaacggg
agcggtgccctgggcagcacgggtggcggcggcccggtgggcagcatggagaatgggaag
ccgggcgccgatgtggtggacctcacgctggacagctcatcgtcctcggaggatgaggag
gaggaggaagaggaggaggaagacgaggacgaagaggggccccggcccaagcgccgctgc
cccttccagaagggcctggtgccggcctgctga

KEGG   Homo sapiens (human): 8554Help
Entry
8554              CDS       T01001                                 

Gene name
PIAS1, DDXBP1, GBP, GU/RH-II, ZMIZ3
Definition
(RefSeq) protein inhibitor of activated STAT 1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04630  Jak-STAT signaling pathway
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8554 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    8554 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    8554 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8554 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    8554 (PIAS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     8554 (PIAS1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   8554 (PIAS1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    8554 (PIAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PINIT zf-MIZ zf-Nse
Motif
Other DBs
NCBI-GeneID: 8554
NCBI-ProteinID: NP_057250
OMIM: 603566
HGNC: 2752
Ensembl: ENSG00000033800
Vega: OTTHUMG00000172645
Pharos: O75925(Tbio)
UniProt: O75925
LinkDB All DBs
Structure
PDB: 

Position
15q23
AA seq 651 aa AA seqDB search
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgccgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgtagtcctgctgtgcaaatgaaaattaaggaactc
tataggcggcggttcccacagaaaatcatgacgcctgcagacttgtccatccccaacgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacaactcacttacgat
ggtcaccctgcatcatcgccattactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgccttgacaccacaacaagtgcagcaa
atcagtagttccatggatatttctgggaccaaatgtgacttcacagtacaggtccagtta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttaccttccacctacaaaaaatggc
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgactgtccaca
acagtaccaaacacgattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagttgactgcggatcca
gacagtgaaatagctacaaccagcctaagggtttctctactatgtccacttggtaaaatg
cggctgacaattccgtgtcgggcccttacatgttctcatctacaatgttttgacgcaact
ctttacattcagatgaatgagaaaaaaccaacctgggtttgtcctgtctgtgataagaag
gctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gactgtgatgaaatacaatttaaggaggatggcacttgggcaccgatgagatcaaaaaag
gaagtacaggaagtttctgcctcttacaatggagtcgatggatgcttgagctccacattg
gagcatcaggtagcgtctcaccaccagtcctcaaataaaaacaagaaagtagaagtgatt
gacctaaccatagacagttcatctgatgaagaggaagaagagccatctgccaagaggacc
tgtccttccctatctcccacatcaccactaaataataaaggcattttaagtcttccacat
caagcatctccagtatcccgcaccccaagccttcctgctgtagacacaagctacattaat
acctccctcatccaagactataggcatcctttccacatgacacccatgccttacgactta
caaggattagatttctttcctttcttatcaggagacaatcagcattacaacacctccttg
cttgccgctgcagcagcagcagtttcagatgatcaagacctcctacactcgtctcggttt
ttcccgtatacctcctcacagatgtttcttgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggaagcagtagtggcagtaacagcagcctggtttcttccaacagc
ctaagggaaagccatagccacaccgtcacaaacaggagcagcacggacacggcatccatc
tttggcatcataccagacattatttcattggactga

KEGG   Homo sapiens (human): 9063Help
Entry
9063              CDS       T01001                                 

Gene name
PIAS2, ARIP3, DIP, MIZ1, PIASX, SIZ2, ZMIZ4
Definition
(RefSeq) protein inhibitor of activated STAT 2
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04630  Jak-STAT signaling pathway
Network
nt06230  Cell cycle G1/S
nt06267  Small cell lung cancer
  Element
N00088  Amplified MYC to p15-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9063 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    9063 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9063 (PIAS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     9063 (PIAS2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   9063 (PIAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP PHD
Motif
Other DBs
NCBI-GeneID: 9063
NCBI-ProteinID: NP_004662
OMIM: 603567
HGNC: 17311
Ensembl: ENSG00000078043
Vega: OTTHUMG00000179301
Pharos: O75928(Tbio)
UniProt: O75928
LinkDB All DBs
Structure
PDB: 

Position
18q21.1
AA seq 621 aa AA seqDB search
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSS
RSETGVITSSGSNIPDIISLD
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcgaagagttgaggaatatggtttctagttttagggtttctgaactacaa
gtattactaggctttgctggacggaataaaagtggacgcaagcatgacctcctgatgagg
gcgctgcatttattgaagagcggctgcagccctgcggttcagattaaaatccgagaattg
tatagacgccgatatccacgaactcttgaaggactttctgatttatccacaatcaaatca
tcggttttcagtttggatggtggctcatcacctgtagaacctgacttggccgtggctgga
atccactcgttgccttccacttcagttacacctcactcaccatcctctcctgttggttct
gtgctgcttcaagatactaagcccacatttgagatgcagcagccatctcccccaattcct
cctgtccatcctgatgtgcagttaaaaaatctgcccttttatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcagcgatttcaagagaagttttttatt
tttgctttgacacctcaacaagttagagagatatgcatatccagggattttttgccaggt
ggtaggagagattatacagtccaagttcagttgagactttgcctggcagagacaagttgc
cctcaagaagataactatccaaatagtctatgtataaaagtaaatgggaagctatttcct
ttgcctggctatgcaccaccgcctaaaaatgggattgaacagaagcgccctggacgcccc
ttgaatattacatctttagttaggttatcttcagctgtgccaaaccaaatttccatttct
tgggcatcagaaattgggaagaattactctatgtctgtatatcttgtacggcagcttaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccaga
gcactaattaaagaaaaacttactgcagatcctgatagtgaaattgctacaactagcctt
cgggtatccttgatgtgccctttaggaaaaatgaggctgacaatcccatgccgtgcagtg
acttgtacacatctgcagtgttttgatgctgccctctatctacaaatgaatgagaaaaag
cccacctggatttgtcctgtgtgtgacaaaaaagctgcctatgaaagtctaatattagat
gggctttttatggaaattctcaatgactgttctgatgtagatgagatcaaattccaagaa
gatggttcttggtgtccaatgagaccgaagaaagaagctatgaaagtatccagccaaccg
tgtacaaaaatagaaagttcaagcgtcctcagtaagccttgttcagtgactgtagccagt
gaggcaagcaagaagaaagtagatgttattgatcttacaatagaaagctcttctgacgaa
gaggaagaccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggtt
gatcctgctgctattccgccttcattaacagactactcagtaccattccaccatacgcca
atatcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagcagt
acgtctgtcaccaccaccagctcccatgaaagcagtactcatgttagttcatccagcagc
aggagtgagacaggggtcataaccagcagtggaagtaacattcctgacatcatctcattg
gactaa

DBGET integrated database retrieval system