KEGG   Homo sapiens (human): 10411Help
Entry
10411             CDS       T01001                                 

Gene name
RAPGEF3, CAMP-GEFI, EPAC, EPAC1, HSU79275, bcm910
Definition
(RefSeq) Rap guanine nucleotide exchange factor 3
  KO
K08014  Rap guanine nucleotide exchange factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04670  Leukocyte transendothelial migration
hsa04720  Long-term potentiation
hsa04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    10411 (RAPGEF3)
   04072 Phospholipase D signaling pathway
    10411 (RAPGEF3)
   04024 cAMP signaling pathway
    10411 (RAPGEF3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    10411 (RAPGEF3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    10411 (RAPGEF3)
  09156 Nervous system
   04726 Serotonergic synapse
    10411 (RAPGEF3)
   04720 Long-term potentiation
    10411 (RAPGEF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF cNMP_binding RasGEF_N DEP
Motif
Other DBs
NCBI-GeneID: 10411
NCBI-ProteinID: NP_001092002
OMIM: 606057
HGNC: 16629
Ensembl: ENSG00000079337
Vega: OTTHUMG00000133667
Pharos: O95398(Tbio)
UniProt: O95398 Q99777
LinkDB All DBs
Position
12q13.11
AA seq 881 aa AA seqDB search
MVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGR
QLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDE
GALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEMEEELAEAVALLSQRGPDALLTVALR
KPPGQRTDEELDLIFEELLHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTS
WYIIWKGSVNVVTHGKGLVTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDF
NRIIKDVEAKTMRLEEHGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLE
AMGPDSSAHDPTETFLSDFLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKR
QQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLEN
GCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASV
REVMAALAQEDGWTKGQVLVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELI
PHPDQLGPTVGSAEGLDLVSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTA
NLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLS
NSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDM
TFIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARI
STCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgagaaggatgcaccggccccgaagctgctcctaccagctgctgctggagcac
cagcgtccgagctgcatccaggggctgcgctggacaccactcaccaacagcgaggagtcc
ctggatttcagcgagagcctggagcaggcctccacagagcgggtgctcagggctgggagg
cagctgcatcggcatctgctggccacctgcccaaacctcatccgagaccggaagtaccac
cttaggctctatcggcagtgctgctctggccgggagctggtggatgggatcttggccctg
ggacttggggtccattcccggagccaagttgtgggaatctgccaggtgctgctggatgaa
ggtgccctctgccatgtgaaacacgactgggccttccaggaccgagatgcccaattctac
cggttccccgggcccgagcccgagcccgtgggaactcatgagatggaggaggagttggcc
gaagctgtggccctgctctcccagcgggggcctgacgccctgctcactgtggcacttcga
aagcccccaggtcagcgcacggatgaagagctggacctcatctttgaggagctgctgcac
atcaaggctgtggcccacctctccaactcggtgaagcgagaattagcggctgttctgctc
tttgaaccacacagcaaggcagggaccgtgttgttcagccagggggacaagggcacttcg
tggtacattatctggaagggatctgtcaacgtggtgacccatggcaaggggctggtgacc
accctgcatgagggagatgattttggacagctggctctggtgaatgatgcaccccgggca
gccaccatcatcctgcgagaagacaactgtcatttcctgcgtgtggacaagcaggacttc
aaccgtatcatcaaggatgtggaggcaaagaccatgcggctggaagaacatggcaaagtg
gtgctggtgctggagagagcctctcagggcgccggcccttcccgacccccaaccccaggc
aggaaccggtatacagtgatgtctggcaccccagagaagatcctagagcttctgttggag
gccatgggaccagattccagtgctcatgacccaacagagacattcctcagcgacttcctc
ctgacccacagggtcttcatgcccagcgcccaactctgcgctgcccttctgcaccacttc
catgtggagcctgcgggtggcagcgagcaggagcgcagcacctacgtctgcaacaagagg
cagcagatcttgcggctggtcagccagtgggtggccctgtatggctccatgctccacact
gaccctgtggccaccagcttcctccagaaactctcagacctggtgggcagggacacccga
ctcagcaacctgctgagggagcagtggccagagaggcggcgatgccacaggttggagaat
ggctgtgggaatgcatctcctcagatgaaggcccggaacttgcctgtttggctccccaac
caggacgagccccttcctggcagcagctgtgccatccaagttggggataaagtcccctat
gacatctgccggccagaccactcagtgttgaccctgcagctgcctgtgacagcctccgtg
agagaggtgatggcagcgttggcccaggaggatggctggaccaaggggcaggtgctggtg
aaggtcaattctgcaggtgatgccattggcctgcagccagatgcccgtggtgtggccaca
tctctggggctcaatgagcgtctctttgttgtcaacccacaggaagtgcatgagctgatc
ccacaccctgaccagctggggcccactgtgggctctgctgaggggctggacctggtgagt
gccaaggacctggcaggccagctgacggaccacgactggagcctcttcaacagtatccac
caggtggagctgatccactatgtgctgggcccccagcatctgcgggatgtcaccaccgcc
aacctggagcgcttcatgcgccgcttcaatgagctgcagtactgggtggccaccgagctg
tgtctctgccccgtgcccggcccccgggcccagctgctcaggaagttcattaagctggcg
gcccacctcaaggagcagaagaatctcaattccttctttgccgtcatgtttggcctcagc
aactcggccatcagccgcctagcccacacctgggagcggctgcctcacaaagtccggaag
ctgtactccgccctcgagaggctgctggatccctcatggaaccaccgggtataccgactg
gccctcgccaagctctcccctcctgtcatccccttcatgccccttcttctcaaagacatg
accttcattcatgagggaaaccacacactagtggagaatctcatcaactttgagaagatg
agaatgatggccagagccgcgcggatgctgcaccactgccgaagccacaaccctgtgcct
ctctcaccactcagaagccgagtttcccacctccacgaggacagccaggtggcgaggatt
tccacatgctcggagcagtccctgagcacccggagtccagccagcacctgggcttatgtc
cagcagctgaaggtcattgacaaccagcgggaactctcccgcctctcccgagagctggag
ccatga

KEGG   Homo sapiens (human): 11069Help
Entry
11069             CDS       T01001                                 

Gene name
RAPGEF4, CAMP-GEFII, CGEF2, EPAC, EPAC_2, EPAC2, Nbla00496
Definition
(RefSeq) Rap guanine nucleotide exchange factor 4
  KO
K04351  Rap guanine nucleotide exchange factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04670  Leukocyte transendothelial migration
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    11069 (RAPGEF4)
   04072 Phospholipase D signaling pathway
    11069 (RAPGEF4)
   04024 cAMP signaling pathway
    11069 (RAPGEF4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    11069 (RAPGEF4)
  09152 Endocrine system
   04911 Insulin secretion
    11069 (RAPGEF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11069 (RAPGEF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11069 (RAPGEF4)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    11069 (RAPGEF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF cNMP_binding DEP RasGEF_N
Motif
Other DBs
NCBI-GeneID: 11069
NCBI-ProteinID: NP_008954
OMIM: 606058
HGNC: 16626
Ensembl: ENSG00000091428
Vega: OTTHUMG00000133677
Pharos: Q8WZA2(Tchem)
UniProt: Q8WZA2
LinkDB All DBs
Position
2q31.1
AA seq 1011 aa AA seqDB search
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQKDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENT
PLIEPHVPLRPANTITKVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTE
LVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLP
TEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHL
STTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV
PAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVF
MPNTQLCPALVAHYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMA
FLEEFYVSVSDDARMIAALKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQK
RQPIRGSDEVLFKVYCMDHTYTTIRVPVATSVKEVISAVADKLGSGEGLIIVKMSSGGEK
VVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVGTVGTFELMSSKDLAYQM
TIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKR
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLM
DPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTART
VRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atggtcgctgcgcacgctgcccattcttcctcctctgccgagtggatcgcctgcctggat
aaaagaccactggagcgatccagcgaagatgtggatataatcttcactcgactgaaagaa
gttaaagcttttgagaaatttcacccaaatctccttcatcagatttgcttatgtggttat
tatgagaatctggaaaagggaataacattatttcgccagggtgatattggaacaaactgg
tatgctgtcctggcagggtctttggatgttaaagtatctgagaccagcagtcaccaggat
gctgtgaccatctgtaccctgggaattgggacggcctttggagagtccattctggacaac
acaccccgccatgcaaccatcgttaccagggagagcagtgaactgctccgcatcgagcag
aaggacttcaaggcactatgggagaaatatcgacagtatatggcaggacttctggctcct
ccttatggtgttatggaaacgggctctaacaatgacaggattcctgacaaggagaacaca
cctctcattgaacctcacgttcctcttcgtcctgctaacaccattaccaaggtcccttca
gagaagatcctcagagctggaaaaattttacgaaatgccattctctctcgagcacctcac
atgataagagatagaaaataccacctaaagacatacagacaatgctgtgtgggaactgaa
ctggtggactggatgatgcagcagacaccatgtgttcactcccggactcaagctgttggc
atgtggcaagtcctgttagaagatggtgttctcaaccacgtggaccaggagcaccatttc
caagacaaatatttattctatcgatttctggatgatgagcacgaggatgcccctttgcct
actgaggaggagaagaaggagtgtgatgaggagctccaggacaccatgctgctgctgtca
cagatgggccccgacgcccacatgaggatgatccttcgcaaaccacctggccagaggact
gtggatgacctagagattatctatgaggagcttcttcatattaaagccttatcccatctt
tctaccacagtgaaacgagagttagcaggtgttctcatttttgagtctcacgccaaagga
gggactgtgttgtttaaccagggggaagaaggtacctcctggtacattattctaaaagga
tcagtgaatgtagtcatttacggcaagggtgtggtctgcaccctgcatgaaggagatgac
ttcggcaagttagcactagtgaatgatgccccacgagctgcctctatcgtcttacgagaa
gataactgccatttcttaagagtagacaaggaggatttcaaccggatcctaagggacgtg
gaggcgaatacagtcagacttaaagaacatgaccaagatgtcttggtgctggagaaggtc
ccagcagggaacagagcttctaatcaaggaaactcacagcctcagcaaaagtatactgtg
atgtcaggaacacctgaaaaaattttagagcattttctagaaacaatacgccttgaggca
actttaaatgaagcaacagattctgttttaaatgactttattatgatgcactgtgttttt
atgccaaatacccagctttgcccggcactggtggcccactaccacgcacagccttcacaa
ggtacagaacaggagaaaatggattatgccctcaacaataagaggcgagtcatccgcctg
gttctacagtgggctgccatgtatggagacctcctgcaagaggatgacgtgtctatggcc
ttcctggaggagttttatgtatctgtatcagatgatgcccggatgattgctgccctcaag
gagcaactgccagagttggagaagattgtcaagcaaatctcagaagatgcaaaggcacca
caaaagaagcacaaggttcttttgcaacagttcaatacgggcgatgagagagcccagaag
cgccagcctatccgcggctctgatgaagttctgtttaaggtctattgcatggaccacacc
tacacaaccattcgggtgccagtggccacttcggtgaaggaagtcatcagtgcagttgcc
gacaagctgggctccggggagggcctgatcatagtcaagatgagttccggaggagaaaag
gtggtgctcaaacctaatgatgtttcagtatttacgacgctcaccattaatggacgcctg
tttgcttgcccgcgagagcaattcgattcactgactcccttaccagaacaggaaggccca
actgttggaacagtgggaacttttgaactgatgagctccaaagatttagcataccagatg
acaatttatgattgggaactcttcaactgcgtgcatgagctggagctaatctatcacaca
tttggaaggcataattttaaaaagaccacagcaaacttggatttgttcctgaggagattt
aatgaaattcagttttgggtcgtcactgagatctgcctttgttctcagctcagcaagcgt
gttcagctattaaaaaaatttattaagatagcagcccactgtaaggagtataaaaatctg
aattccttttttgccatcgtcatgggactaagtaacgttgctgtgagccgcttggcacta
acgtgggagaaactgccaagcaagttcaagaagttctatgcggagtttgaaagtttaatg
gacccttcaaggaaccacagggcctacaggctgacagtagctaagctggaacctcctctc
atccccttcatgcctttgctcattaaagatatgacatttactcatgaggggaacaagacg
ttcattgacaatctagtaaactttgaaaaaatgcgcatgattgcaaatacggccagaaca
gtgagatactacaggagccaacccttcaatcctgatgcagctcaagctaataagaaccat
caggatgtccggagttatgtacggcaattaaatgtgattgacaaccagagaactttatca
cagatgtcacacagattagagcctcgtcgaccatag

DBGET integrated database retrieval system