KEGG   Homo sapiens (human): 10439Help
Entry
10439             CDS       T01001                                 

Gene name
OLFM1, AMY, NOE1, NOELIN1, OlfA
Definition
(RefSeq) olfactomedin 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: OLF Noelin-1 EzrA Helo_like_N zf-C4H2 APG17 Lipoprotein_7 GCP_C_terminal Atg14 BLOC1_2 Baculo_PEP_C Myosin_tail_1 Xpo1 AAA_13 Exonuc_VII_L DUF4795 FUSC CENP-Q TBCC_N Laminin_II
Motif
Other DBs
NCBI-GeneID: 10439
NCBI-ProteinID: NP_001269540
OMIM: 605366
HGNC: 17187
Ensembl: ENSG00000130558
Vega: OTTHUMG00000020897
Pharos: Q99784(Tbio)
UniProt: Q99784
LinkDB All DBs
Structure
PDB: 

Position
9q34.3
AA seq 485 aa AA seqDB search
MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTGVLPTNPEESW
QVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQ
YVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQ
FKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVTVK
TSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHPWSG
TGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVD
ESGLWAVYATNQNAGNIVVSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNGYSG
GTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLFHVI
RSDEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgccgctgctcaagatcggggtcgtgctgagcaccatggccatgatcactaac
tggatgtcccagacgctgccctcgctggtgggcctcaacaccaccaagctctcggcggcc
ggcggcgggacgctggaccgcagcaccggcgtgctgcccaccaaccctgaggagagctgg
caggtgtacagctctgcccaggacagcgagggcaggtgtatctgcacagtggtcgctcca
cagcagaccatgtgttcacgggatgcccgcacaaaacagctgaggcagctactggagaag
gtgcagaacatgtctcaatccatagaggtcttggacaggcggacccagagagacttgcag
tacgtggagaagatggagaaccaaatgaaaggactggagtccaagttcaaacaggtggag
gagagtcataagcaacacctggccaggcagtttaaggcgataaaagcgaaaatggatgaa
cttaggcctttgatacctgtgttggaagagtacaaggccgatgccaaattggtattgcag
tttaaagaggaggtccagaatctgacgtcagtgcttaacgagctgcaagaggaaattggc
gcctatgactacgatgaacttcagagcagagtgtccaatcttgaagaaaggctccgtgca
tgcatgcaaaaactagcttgcgggaagttgacgggcatcagtgaccccgtgactgtcaag
acctccggctcgaggttcggatcctggatgacagaccctctcgcccctgaaggcgataac
cgggtgtggtacatggacggctatcacaacaaccgcttcgtacgtgagtacaagtccatg
gttgacttcatgaacacggacaatttcacctcccaccgtctcccccacccctggtcgggc
acggggcaggtggtctacaacggttctatctacttcaacaagttccagagccacatcatc
atcaggtttgacctgaagacagagaccatcctcaagacccgcagcctggactatgccggt
tacaacaacatgtaccactacgcctggggtggccactcggacatcgacctcatggtggac
gagagcgggctgtgggccgtgtacgccaccaaccagaacgctggcaacatcgtggtcagt
aggctggaccccgtgtccctgcagaccctgcagacctggaacacgagctaccccaagcgc
agcgccggggaggccttcatcatctgcggcacgctgtacgtcaccaacggctactcaggg
ggtaccaaggtccactatgcataccagaccaatgcctccacctatgaatacatcgacatc
ccattccagaacaaatactcccacatctccatgctggactacaaccccaaggaccgggcc
ctgtatgcctggaacaacggccaccagatcctctacaacgtgaccctcttccacgtcatc
cgctccgacgagttgtag

DBGET integrated database retrieval system