KEGG   Homo sapiens (human): 1045Help
Entry
1045              CDS       T01001                                 

Gene name
CDX2, CDX-3, CDX2/AS, CDX3
Definition
(RefSeq) caudal type homeobox 2
  KO
K22234  homeobox protein CDX2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05226  Gastric cancer
Network
nt06240  Transcription
nt06261  Gastric cancer
  Element
N00250  CDX2-overexpression to transcriptional activation
N00251  CDX2-overexpression to transcriptional repression
Disease
H00018  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05226 Gastric cancer
    1045 (CDX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1045 (CDX2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Cad
    1045 (CDX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caudal_act Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 1045
NCBI-ProteinID: NP_001256
OMIM: 600297
HGNC: 1806
Ensembl: ENSG00000165556
Vega: OTTHUMG00000016640
Pharos: Q99626(Tbio)
UniProt: Q99626
LinkDB All DBs
Structure
PDB: 

Position
13q12.2
AA seq 313 aa AA seqDB search
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQS
PGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPH
HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ
VKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK
ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVL
GPTGGVLNPTVTQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtgagctacctcctggacaaggacgtgagcatgtaccctagctccgtgcgccac
tctggcggcctcaacctggcgccgcagaacttcgtcagccccccgcagtacccggactac
ggcggttaccacgtggcggccgcagctgcagcggcagcgaacttggacagcgcgcagtcc
ccggggccatcctggccggcagcgtatggcgccccactccgggaggactggaatggctac
gcgcccggaggcgccgcggccgccgccaacgccgtggctcacggcctcaacggtggctcc
ccggccgcagccatgggctacagcagccccgcagactaccatccgcaccaccacccgcat
caccacccgcaccacccggccgccgcgccttcctgcgcttctgggctgctgcaaacgctc
aaccccggccctcctgggcccgccgccaccgctgccgccgagcagctgtctcccggcggc
cagcggcggaacctgtgcgagtggatgcggaagccggcgcagcagtccctcggcagccaa
gtgaaaaccaggacgaaagacaaatatcgagtggtgtacacggaccaccagcggctggag
ctggagaaggagtttcactacagtcgctacatcaccatccggaggaaagccgagctagcc
gccacgctggggctctctgagaggcaggttaaaatctggtttcagaaccgcagagcaaag
gagaggaaaatcaacaagaagaagttgcagcagcaacagcagcagcagccaccacagccg
cctccgccgccaccacagcctccccagcctcagccaggtcctctgagaagtgtcccagag
cccttgagtccggtgtcttccctgcaagcctcagtgcctggctctgtccctggggttctg
gggccaactgggggggtgctaaaccccaccgtcacccagtga

DBGET integrated database retrieval system