KEGG   Homo sapiens (human): 10454Help
Entry
10454             CDS       T01001                                 

Gene name
TAB1, 3'-Tab1, MAP3K7IP1
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06110  MAPK signaling (virus)
nt06121  TLR signaling (virus)
nt06123  TNF signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    10454 (TAB1)
   04064 NF-kappa B signaling pathway
    10454 (TAB1)
   04668 TNF signaling pathway
    10454 (TAB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    10454 (TAB1)
   04621 NOD-like receptor signaling pathway
    10454 (TAB1)
  09158 Development
   04380 Osteoclast differentiation
    10454 (TAB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    10454 (TAB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    10454 (TAB1)
   05161 Hepatitis B
    10454 (TAB1)
   05168 Herpes simplex virus 1 infection
    10454 (TAB1)
   05169 Epstein-Barr virus infection
    10454 (TAB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    10454 (TAB1)
   05140 Leishmaniasis
    10454 (TAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C
Motif
Other DBs
NCBI-GeneID: 10454
NCBI-ProteinID: NP_006107
OMIM: 602615
HGNC: 18157
Ensembl: ENSG00000100324
Vega: OTTHUMG00000151102
Pharos: Q15750(Tbio)
UniProt: Q15750 A8K6K3
LinkDB All DBs
Structure
PDB: 

Position
22q13.1
AA seq 504 aa AA seqDB search
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVVTAP
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcttgctgcagagtgagcagcagccaagctggacagatgac
ctgcctctctgccacctctctggggttggctcagcctccaaccgcagctactctgctgat
ggcaagggcactgagagccacccgccagaggacagctggctcaagttcaggagtgagaac
aactgcttcctgtatggggtcttcaacggctatgatggcaaccgagtgaccaacttcgtg
gcccagcggctgtccgcagagctcctgctgggccagctgaatgccgagcacgccgaggcc
gatgtgcggcgtgtgctgctgcaggccttcgatgtggtggagaggagcttcctggagtcc
attgacgacgccttggctgagaaggcaagcctccagtcgcaattgccagagggagtccct
cagcaccagctgcctcctcagtatcagaagatccttgagagactcaagacgttagagagg
gaaatttcgggaggggccatggccgttgtggcggtccttctcaacaacaagctctacgtc
gccaatgtcggtacaaaccgtgcacttttatgcaaatcgacagtggatgggttgcaggtg
acacagctgaacgtggaccacaccacagagaacgaggatgagctcttccgtctttcgcag
ctgggcttggatgctggaaagatcaagcaggtggggatcatctgtgggcaggagagcacc
cggcggatcggggattacaaggttaaatatggctacacggacattgaccttctcagcgct
gccaagtccaaaccaatcatcgcagagccagaaatccatggggcacagccgctggatggg
gtgacgggcttcttggtgctgatgtcggaggggttgtacaaggccctagaggcagcccat
gggcctgggcaggccaaccaggagattgctgcgatgattgacactgagtttgccaagcag
acctccctggacgcagtggcccaggccgtcgtggaccgggtgaagcgcatccacagcgac
accttcgccagtggtggggagcgtgccaggttctgcccccggcacgaggacatgaccctg
ctagtgaggaactttggctacccgctgggcgaaatgagccagcccacaccgagcccagcc
ccagctgcaggaggacgagtgtaccctgtgtctgtgccatactccagcgcccagagcacc
agcaagaccagcgtgaccctctcccttgtcatgccctcccagggccagatggtcaacggg
gctcacagtgcttccaccctggacgaagccacccccaccctcaccaaccaaagcccgacc
ttaaccctgcagtccaccaacacgcacacgcagagcagcagctccagctctgacggaggc
ctcttccgctcccggcccgcccactcgctcccgcctggcgaggacggtcgtgttgagccc
tatgtggactttgctgagttttaccgcctctggagcgtggaccatggcgagcagagcgtg
gtgacagcaccgtag

KEGG   Homo sapiens (human): 23118Help
Entry
23118             CDS       T01001                                 

Gene name
TAB2, CHTD2, MAP3K7IP2, TAB-2
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06110  MAPK signaling (virus)
nt06121  TLR signaling (virus)
nt06123  TNF signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00549  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
N00561  HSV ICP0 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
Disease
H02199  Congenital heart defects, multiple type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    23118 (TAB2)
   04064 NF-kappa B signaling pathway
    23118 (TAB2)
   04668 TNF signaling pathway
    23118 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    23118 (TAB2)
   04621 NOD-like receptor signaling pathway
    23118 (TAB2)
   04657 IL-17 signaling pathway
    23118 (TAB2)
  09158 Development
   04380 Osteoclast differentiation
    23118 (TAB2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    23118 (TAB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    23118 (TAB2)
   05162 Measles
    23118 (TAB2)
   05161 Hepatitis B
    23118 (TAB2)
   05168 Herpes simplex virus 1 infection
    23118 (TAB2)
   05169 Epstein-Barr virus infection
    23118 (TAB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    23118 (TAB2)
   05140 Leishmaniasis
    23118 (TAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUE zf-RanBP DLP_helical DivIC
Motif
Other DBs
NCBI-GeneID: 23118
NCBI-ProteinID: NP_001278963
OMIM: 605101
HGNC: 17075
Ensembl: ENSG00000055208 ENSG00000228408
Vega: OTTHUMG00000015783
Pharos: Q9NYJ8(Tbio)
UniProt: Q9NYJ8
LinkDB All DBs
Structure
PDB: 

Position
6q25.1
AA seq 693 aa AA seqDB search
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
cctgaagtacctgaagttgttgtatccaggtgcatgttacagaataataataacctggat
gcctgctgtgctgttctctctcaggagagtacaagatatctttatggtgaaggagacttg
aatttttcagatgattctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcaatcacagaacatttaccaccatggaagagaaggaagtaggatgaatggaagt
aggactctaacgcacagcattagtgatggacaacttcaaggtggccagtccaatagtgaa
ctatttcagcaggagccacagacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgtccagttcctctggtgcttcaaattcagcaccacatcttggatttcacttaggc
agcaaaggaacatctagcctttctcaacaaactcccagatttaatcccattatggtaact
ttagccccaaatatccagactggtcgtaatactcctacatctttgcacatacatggtgta
cctccacctgtacttaacagtccacagggaaattctatctatattaggccttacattaca
actcctggtggtacaactcgacagacacaacagcattctggctgggtatctcagtttaat
cccatgaaccctcagcaagtttatcagccttcacagcctggtccctggactacttgtcct
gcatctaatcctctgtcacatacctcatctcaacagccaaatcagcaaggccaccagacc
tctcatgtctacatgccaatcagttcacctactacttcacaaccaccaaccattcattca
tctggtagctcacagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaacccccacaaagaaataattcttcaaaa
ctgcgttcttctggacctcgaacctccagcacttcctcttcagtcaatagccagacctta
aacagaaatcagcccactgtttacatagctgccagccccccaaatacggatgagctgatg
tcccgtagtcaacctaaggtctatatttcagcgaatgctgccacaggagatgaacaggtc
atgcggaatcagcccacactcttcatatccacaaactctggagcatctgctgcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttattcatcaccatcctcccaaaagt
cgagcaataggcaataactctgcaacctctcctcgagtggtagtcactcagcccaatacg
aaatacactttcaaaattacagtctctcccaataagccccctgcagtttcaccaggggtg
gtgtcccctacctttgaacttacaaatcttcttaatcatcctgatcattatgtagaaacc
gagaatattcagcacctcacggaccctacattagcacatgtggatagaataagtgaaaca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctcttttggtacaccag
aaggccagaatggaacgacttcaaagagaacttgagattcaaaagaaaaagctggataaa
ttaaaatctgaggttaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattctatatcccagataccttcccttgaagaaatgcagcagctgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaaccccagcgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccatcatcaaaacaccaaagactcaagacaca
gaagatgatgagggagctcagtggaattgtaccgcctgtacttttttgaaccatccagcc
ttaattcgctgtgaacagtgtgagatgccaaggcatttctga

DBGET integrated database retrieval system