KEGG   Homo sapiens (human): 10455
Entry
10455             CDS       T01001                                 

Gene name
ECI2, ACBD2, DRS-1, DRS1, HCA88, PECI, dJ1013A10.3
Definition
(RefSeq) enoyl-CoA delta isomerase 2
  KO
K13239  Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    10455 (ECI2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    10455 (ECI2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     10455 (ECI2)
SSDB
Motif
Pfam: ECH_1 ACBP ECH_2
Other DBs
NCBI-GeneID: 10455
NCBI-ProteinID: NP_996667
OMIM: 608024
HGNC: 14601
Ensembl: ENSG00000198721
Vega: OTTHUMG00000014158
Pharos: O75521(Tbio)
UniProt: O75521
LinkDB
Structure
PDB: 
4U19 2F6Q 4U18 4U1A 2CQU

Position
6p25.2
AA seq 394 aa
MAMAYLAWRLARRSCPSSLQVTSFPVVQLHMNRTAMRASQKDFENSMNQVKLLKKDPGNE
VKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAARQNYVDLVSSLSP
SLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAAS
KDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIA
VVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEML
IFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKL
HAVNAEECNVLQGRWLSDECTNAVVNFLSRKSKL
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggcgatggcgtacttggcttggagactggcgcggcgttcgtgtccgagttctctgcag
gtcactagtttcccggtagttcagctgcacatgaatagaacagcaatgagagccagtcag
aaggactttgaaaattcaatgaatcaagtgaaactcttgaaaaaggatccaggaaacgaa
gtgaagctaaaactctacgcgctatataagcaggccactgaaggaccttgtaacatgccc
aaaccaggtgtatttgacttgatcaacaaggccaaatgggacgcatggaatgcccttggc
agcctgcccaaggaagctgccaggcagaactatgtggatttggtgtccagtttgagtcct
tcattggaatcctctagtcaggtggagcctggaacagacaggaaatcaactgggtttgaa
actctggtggtgacctccgaagatggcatcacaaagatcatgttcaaccggcccaaaaag
aaaaatgccataaacactgagatgtatcatgaaattatgcgtgcacttaaagctgccagc
aaggatgactcaatcatcactgttttaacaggaaatggtgactattacagtagtgggaat
gatctgactaacttcactgatattccccctggtggagtagaggagaaagctaaaaataat
gccgttttactgagggaatttgtgggctgttttatagattttcctaagcctctgattgca
gtggtcaatggtccagctgtgggcatctccgtcaccctccttgggctattcgatgccgtg
tatgcatctgacagggcaacatttcatacaccatttagtcacctaggccaaagtccggaa
ggatgctcctcttacacttttccgaagataatgagcccagccaaggcaacagagatgctt
atttttggaaagaagttaacagcgggagaggcatgtgctcaaggacttgttactgaagtt
ttccctgatagcacttttcagaaagaagtctggaccaggctgaaggcatttgcaaagctt
cccccaaatgccttgagaatttcaaaagaggtaatcaggaaaagagagagagaaaaacta
cacgctgttaatgctgaagaatgcaatgtccttcagggaagatggctatcagatgaatgc
acaaatgctgtggtgaacttcttatccagaaaatcaaaactgtga

DBGET integrated database retrieval system