KEGG   Homo sapiens (human): 10457
Entry
10457             CDS       T01001                                 

Gene name
GPNMB, HGFIN, NMB, PLCA3
Definition
(RefSeq) glycoprotein nmb
  KO
K20732  transmembrane glycoprotein NMB
Organism
hsa  Homo sapiens (human)
Drug target
Glembatumumab: D09623
Glembatumumab vedotin: D09912
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10457 (GPNMB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Others
    10457 (GPNMB)
SSDB
Motif
Pfam: PKD_4 PKD TMEM132D_C
Other DBs
NCBI-GeneID: 10457
NCBI-ProteinID: NP_001005340
OMIM: 604368
HGNC: 4462
Ensembl: ENSG00000136235
Vega: OTTHUMG00000022811
Pharos: Q14956(Tbio)
UniProt: Q14956
LinkDB
Position
7p15.3
AA seq 572 aa
MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYP
VWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNC
RNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTL
GQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFV
TMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTINYKWSFGDNTGLFVSTNHTVN
HTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNTPGPAGDNPLE
LSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI
PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTS
TLISVPDRDPASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKG
LSVFLNRAKAVFFPGNQEKDPLLKNQEFKGVS
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggaatgtctctactatttcctgggatttctgctcctggctgcaagattgccacttgat
gccgccaaacgatttcatgatgtgctgggcaatgaaagaccttctgcttacatgagggag
cacaatcaattaaatggctggtcttctgatgaaaatgactggaatgaaaaactctaccca
gtgtggaagcggggagacatgaggtggaaaaactcctggaagggaggccgtgtgcaggcg
gtcctgaccagtgactcaccagccctcgtgggctcaaatataacatttgcggtgaacctg
atattccctagatgccaaaaggaagatgccaatggcaacatagtctatgagaagaactgc
agaaatgaggctggtttatctgctgatccgtatgtttacaactggacagcatggtcagag
gacagtgacggggaaaatggcaccggccaaagccatcataacgtcttccctgatgggaaa
ccttttcctcaccaccccggatggagaagatggaatttcatctacgtcttccacacactt
ggtcagtatttccagaaattgggacgatgttcagtgagagtttctgtgaacacagccaat
gtgacacttgggcctcaactcatggaagtgactgtctacagaagacatggacgggcatat
gttcccatcgcacaagtgaaagatgtgtacgtggtaacagatcagattcctgtgtttgtg
actatgttccagaagaacgatcgaaattcatccgacgaaaccttcctcaaagatctcccc
attatgtttgatgtcctgattcatgatcctagccacttcctcaattattctaccattaac
tacaagtggagcttcggggataatactggcctgtttgtttccaccaatcatactgtgaat
cacacgtatgtgctcaatggaaccttcagccttaacctcactgtgaaagctgcagcacca
ggaccttgtccgccaccgccaccaccacccagaccttcaaaacccaccccttctttagca
actactctaaaatcttatgattcaaacaccccaggacctgctggtgacaaccccctggag
ctgagtaggattcctgatgaaaactgccagattaacagatatggccactttcaagccacc
atcacaattgtagagggaatcttagaggttaacatcatccagatgacagacgtcctgatg
ccggtgccatggcctgaaagctccctaatagactttgtcgtgacctgccaagggagcatt
cccacggaggtctgtaccatcatttctgaccccacctgcgagatcacccagaacacagtc
tgcagccctgtggatgtggatgagatgtgtctgctgactgtgagacgaaccttcaatggg
tctgggacgtactgtgtgaacctcaccctgggggatgacacaagcctggctctcacgagc
accctgatttctgttcctgacagagacccagcctcgcctttaaggatggcaaacagtgcc
ctgatctccgttggctgcttggccatatttgtcactgtgatctccctcttggtgtacaaa
aaacacaaggaatacaacccaatagaaaatagtcctgggaatgtggtcagaagcaaaggc
ctgagtgtctttctcaaccgtgcaaaagccgtgttcttcccgggaaaccaggaaaaggat
ccgctactcaaaaaccaagaatttaaaggagtttcttaa

DBGET integrated database retrieval system