KEGG   Homo sapiens (human): 10478
Entry
10478             CDS       T01001                                 

Gene name
SLC25A17, PMP34
Definition
(RefSeq) solute carrier family 25 member 17
  KO
K13354  solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    10478 (SLC25A17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10478 (SLC25A17)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   10478 (SLC25A17)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 10478
NCBI-ProteinID: NP_006349
OMIM: 606795
HGNC: 10987
Ensembl: ENSG00000100372
Vega: OTTHUMG00000151139
Pharos: O43808(Tbio)
UniProt: O43808
LinkDB
Position
22q13.2
AA seq 307 aa
MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEG
LLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTT
PLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPA
IQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPE
NRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMG
LKRAHQH
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcttccgtgctgtcctacgaaagcctggtccacgccgtggccggagccgtgggaagc
gtgacagcaatgacagtgttttttcccctggatacagctagacttcgacttcaggttgat
gagaaaagaaaatccaaaactacacacatggtgctcctggagatcattaaagaagaagga
ctcctggcaccatatcgagggtggtttccagtgatttccagtctctgctgctccaatttt
gtctatttctacacttttaatagcctcaaagcactctgggtcaaaggtcaacattctacc
actggaaaagatctggtagttgggtttgttgcaggagtggttaatgtgttgctaacaact
ccactctgggtggtaaacaccagactgaagcttcaaggagcaaaatttaggaatgaagac
attgtaccaacaaactacaaaggtatcattgatgcttttcatcagatcattcgcgatgaa
ggaatctcggctttatggaatggcacatttccctcattgctgttggtcttcaatcctgcc
atccagttcatgttttatgaaggtttaaaacggcagcttttaaagaaacggatgaagctt
tcttccttggatgtgttcatcattggtgcagtagccaaagcgattgccaccacggtgacc
tatcccctgcagacggtacagtcaattctgaggtttgggcgtcatagactaaacccagaa
aacagaacattgggaagtcttcggaatattctctatcttcttcaccaacgagtaagacgt
tttggaataatgggactctacaaaggccttgaagccaaactgctgcagacagtcctcact
gctgctctcatgttccttgtttatgagaaactgacagctgccaccttcacagttatgggg
ctgaagcgtgcacaccaacactga

DBGET integrated database retrieval system