KEGG   Homo sapiens (human): 10482
Entry
10482             CDS       T01001                                 

Gene name
NXF1, MEX67, TAP
Definition
(RefSeq) nuclear RNA export factor 1
  KO
K14284  nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N00586  Nuclear export of mRNA
N00587  HSV ICP27 to Nuclear export of mRNA
N00746  IAV NS1 to nuclear export of mRNA
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    10482 (NXF1)
   03015 mRNA surveillance pathway
    10482 (NXF1)
   03008 Ribosome biogenesis in eukaryotes
    10482 (NXF1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10482 (NXF1)
  09172 Infectious disease: viral
   05164 Influenza A
    10482 (NXF1)
   05168 Herpes simplex virus 1 infection
    10482 (NXF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10482 (NXF1)
   03009 Ribosome biogenesis [BR:hsa03009]
    10482 (NXF1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     10482 (NXF1)
   mRNA cycle factors
    Stress granule specific factors
     10482 (NXF1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    10482 (NXF1)
SSDB
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_4 LRR_8 LRR_9
Other DBs
NCBI-GeneID: 10482
NCBI-ProteinID: NP_006353
OMIM: 602647
HGNC: 8071
Ensembl: ENSG00000162231
Vega: OTTHUMG00000167612
Pharos: Q9UBU9(Tbio)
UniProt: Q9UBU9
LinkDB
Structure
PDB: 

Position
11q12.3
AA seq 619 aa
MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVA
MSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
KITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKIL
DRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVA
QNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG
NELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPI
AFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFV
VDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNAS
SEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSA
QAFTHLKAKGEIPEVAFMK
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggcggacgaggggaagtcgtacagcgaacacgatgatgaacgcgttaatttccctcaa
agaaagaagaaaggccggggtcccttccggtggaaatatggtgaaggaaaccgtaggtct
ggaagaggcggttctggtattcggtcttcccgccttgaggaagatgatggagatgtggca
atgagtgatgcccaggatggtccccgagtacgatacaacccctataccacccgacctaac
cgtcggggtgatacttggcatgatcgagatcgcattcatgttactgtgcggagagacaga
gctcctccagagagaggaggggctggcaccagccaggatgggacctcaaagaactggttc
aagattacaattccttatggcagaaagtatgacaaggcatggctcctgagcatgattcag
agcaagtgcagtgtgcccttcacccctattgagtttcactatgagaatacacgggcccag
ttcttcgttgaagacgccagtactgcctctgcattgaaggctgtcaactataagattttg
gatcgggagaaccgaaggatatctatcatcatcaactcttctgctccaccccacactata
ctgaatgaactgaagccagaacaagtagaacagctaaagctgatcatgagcaaacgatac
gatggctcccaacaagcccttgacctcaaaggcctccgttcagacccagatttggtggcc
cagaacattgacgttgtcctgaatcgcagaagctgtatggcagctaccctgaggatcatt
gaagagaacatccctgagctattgtccttgaacttgagcaacaacaggctgtacaggctg
gatgacatgtctagcattgttcagaaggcacccaacctgaagatcctaaacctttctgga
aatgaattgaagtctgagcgggaattggacaagataaaggggctgaagctagaagagctc
tggctcgatggaaactccctgtgtgacaccttccgagaccagtccacctacatcagcgcc
attcgcgaacgatttcccaagttactacgcctggatggccatgagctacccccaccaatt
gcctttgatgttgaagcccccacgacgttaccgccctgcaagggaagctattttggaaca
gaaaacttgaagagtctggtcttgcacttcctgcaacagtactatgcaatttacgactct
ggagaccgacaagggctcctggatgcctaccatgatggggcctgctgttccctgagcatt
cctttcattcctcagaaccctgcccgaagcagcttagccgagtatttcaaggatagcaga
aatgtgaagaagcttaaagaccctaccttgcggttccggctgctgaagcacacgcgtctc
aacgttgttgccttcctcaatgagttgcccaaaacccagcacgacgtcaattccttcgtg
gtagacataagcgcccagacaagcacattgctgtgtttttctgtcaatggagtcttcaag
gaagtggacggaaagtcccgggattctttgcgagccttcacccggacattcattgctgtt
cctgctagcaattcagggctatgtattgtaaatgatgagctatttgtgcggaatgccagt
tctgaagagatccaaagagccttcgctatgcctgcacccacgccttcctccagcccggtg
cccaccctctctccagagcagcaggaaatgttgcaagcattctctacccagtctggcatg
aacctcgagtggtcccagaagtgccttcaggacaacaactgggactacaccagatctgcc
caggccttcactcatctcaaggccaagggcgagatcccagaagtggcattcatgaagtga

DBGET integrated database retrieval system