KEGG   Homo sapiens (human): 10482
Entry
10482             CDS       T01001                                 

Gene name
NXF1, MEX67, TAP
Definition
(RefSeq) nuclear RNA export factor 1
  KO
K14284  nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N00586  Nuclear export of mRNA
N00587  HSV ICP27 to Nuclear export of mRNA
N00746  IAV NS1 to nuclear export of mRNA
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    10482 (NXF1)
   03015 mRNA surveillance pathway
    10482 (NXF1)
   03008 Ribosome biogenesis in eukaryotes
    10482 (NXF1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10482 (NXF1)
  09172 Infectious disease: viral
   05164 Influenza A
    10482 (NXF1)
   05168 Herpes simplex virus 1 infection
    10482 (NXF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10482 (NXF1)
   03009 Ribosome biogenesis [BR:hsa03009]
    10482 (NXF1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     10482 (NXF1)
   mRNA cycle factors
    Stress granule specific factors
     10482 (NXF1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    10482 (NXF1)
SSDB
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_4 LRR_8 LRR_9
Other DBs
NCBI-GeneID: 10482
NCBI-ProteinID: NP_006353
OMIM: 602647
HGNC: 8071
Ensembl: ENSG00000162231
Vega: OTTHUMG00000167612
Pharos: Q9UBU9(Tbio)
UniProt: Q9UBU9
LinkDB
Structure
PDB: 

Position
11q12.3
AA seq 619 aa
MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVA
MSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
KITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKIL
DRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVA
QNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG
NELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPI
AFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFV
VDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNAS
SEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSA
QAFTHLKAKGEIPEVAFMK
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggcggacgaggggaagtcgtacagcgaacacgatgatgaacgcgttaatttccctcaa
agaaagaagaaaggccggggtcccttccggtggaaatatggtgaaggaaaccgtaggtct
ggaagaggcggttctggtattcggtcttcccgccttgaggaagatgatggagatgtggca
atgagtgatgcccaggatggtccccgagtacgatacaacccctataccacccgacctaac
cgtcggggtgatacttggcatgatcgagatcgcattcatgttactgtgcggagagacaga
gctcctccagagagaggaggggctggcaccagccaggatgggacctcaaagaactggttc
aagattacaattccttatggcagaaagtatgacaaggcatggctcctgagcatgattcag
agcaagtgcagtgtgcccttcacccctattgagtttcactatgagaatacacgggcccag
ttcttcgttgaagacgccagtactgcctctgcattgaaggctgtcaactataagattttg
gatcgggagaaccgaaggatatctatcatcatcaactcttctgctccaccccacactata
ctgaatgaactgaagccagaacaagtagaacagctaaagctgatcatgagcaaacgatac
gatggctcccaacaagcccttgacctcaaaggcctccgttcagacccagatttggtggcc
cagaacattgacgttgtcctgaatcgcagaagctgtatggcagctaccctgaggatcatt
gaagagaacatccctgagctattgtccttgaacttgagcaacaacaggctgtacaggctg
gatgacatgtctagcattgttcagaaggcacccaacctgaagatcctaaacctttctgga
aatgaattgaagtctgagcgggaattggacaagataaaggggctgaagctagaagagctc
tggctcgatggaaactccctgtgtgacaccttccgagaccagtccacctacatcagcgcc
attcgcgaacgatttcccaagttactacgcctggatggccatgagctacccccaccaatt
gcctttgatgttgaagcccccacgacgttaccgccctgcaagggaagctattttggaaca
gaaaacttgaagagtctggtcttgcacttcctgcaacagtactatgcaatttacgactct
ggagaccgacaagggctcctggatgcctaccatgatggggcctgctgttccctgagcatt
cctttcattcctcagaaccctgcccgaagcagcttagccgagtatttcaaggatagcaga
aatgtgaagaagcttaaagaccctaccttgcggttccggctgctgaagcacacgcgtctc
aacgttgttgccttcctcaatgagttgcccaaaacccagcacgacgtcaattccttcgtg
gtagacataagcgcccagacaagcacattgctgtgtttttctgtcaatggagtcttcaag
gaagtggacggaaagtcccgggattctttgcgagccttcacccggacattcattgctgtt
cctgctagcaattcagggctatgtattgtaaatgatgagctatttgtgcggaatgccagt
tctgaagagatccaaagagccttcgctatgcctgcacccacgccttcctccagcccggtg
cccaccctctctccagagcagcaggaaatgttgcaagcattctctacccagtctggcatg
aacctcgagtggtcccagaagtgccttcaggacaacaactgggactacaccagatctgcc
caggccttcactcatctcaaggccaagggcgagatcccagaagtggcattcatgaagtga

KEGG   Homo sapiens (human): 29107
Entry
29107             CDS       T01001                                 

Gene name
NXT1, MTR2, P15
Definition
(RefSeq) nuclear transport factor 2 like export factor 1
  KO
K14285  NTF2-related export protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
Network
nt06170  Influenza A virus (IAV)
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N00746  IAV NS1 to nuclear export of mRNA
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    29107 (NXT1)
   03015 mRNA surveillance pathway
    29107 (NXT1)
   03008 Ribosome biogenesis in eukaryotes
    29107 (NXT1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29107 (NXT1)
  09172 Infectious disease: viral
   05164 Influenza A
    29107 (NXT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    29107 (NXT1)
   03009 Ribosome biogenesis [BR:hsa03009]
    29107 (NXT1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     29107 (NXT1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    29107 (NXT1)
SSDB
Motif
Pfam: NTF2 Cofilin_ADF
Other DBs
NCBI-GeneID: 29107
NCBI-ProteinID: NP_037380
OMIM: 605811
HGNC: 15913
Ensembl: ENSG00000132661
Vega: OTTHUMG00000032059
Pharos: Q9UKK6(Tbio)
UniProt: Q9UKK6
LinkDB
Structure
PDB: 
1JKG 1JN5 4WYK 6E5U

Position
20p11.21
AA seq 140 aa
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcatctgtggatttcaagacctatgtggatcaggcctgcagagctgctgaggagttt
gtcaatgtctactacaccaccatggataagcggcggcgtttgctgtcccgcctgtacatg
ggcacagccaccctggtctggaatggcaatgctgtttcaggacaagaatccttgagtgag
ttttttgaaatgttgccttccagcgagttccaaatcagcgtggtagactgccagcctgtt
catgatgaagccacaccaagccagaccacggtccttgttgtcatctgtggatcagtgaag
tttgaggggaacaaacaacgggacttcaaccagaacttcatcctgaccgcccaggcctca
cccagcaacacagtgtggaagatcgcaagtgactgcttccgcttccaggactgggccagc
tag

KEGG   Homo sapiens (human): 11100
Entry
11100             CDS       T01001                                 

Gene name
HNRNPUL1, E1B-AP5, E1BAP5, HNRPUL1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein U like 1
  KO
K15047  heterogeneous nuclear ribonucleoprotein U-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Network
nt06170  Influenza A virus (IAV)
  Element
N00746  IAV NS1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    11100 (HNRNPUL1)
SSDB
Motif
Pfam: AAA_33 SPRY SAP SAP_new25 AAA_18 SRP54
Other DBs
NCBI-GeneID: 11100
NCBI-ProteinID: NP_008971
OMIM: 605800
HGNC: 17011
Ensembl: ENSG00000105323
Vega: OTTHUMG00000182740
Pharos: Q9BUJ2(Tbio)
UniProt: Q9BUJ2
LinkDB
Structure
PDB: 
1ZRJ

Position
19q13.2
AA seq 856 aa
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHI
NEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQEN
ESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRG
RGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFA
YLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPF
SYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQK
EALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVL
IQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKD
RTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRK
AGPPPEKRFDNRGGGGFRGRGGGGGFQRYENRGPPGGNRGGFQNRGGGSGGGGNYRGGFN
RSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA
RNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPP
PPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY
DYGSYSGNTQGGTSTQ
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggatgtgcgccgtctgaaggtgaacgaacttcgcgaggagctgcagcgccgcggcctg
gacactcgaggcctcaaggccgagcttgctgagcggctgcaggcggcgttggaggccgag
gagcctgacgacgagcgggagctcgacgccgacgacgaaccggggcgacccgggcacatc
aacgaggaggtcgagaccgaggggggctccgagctggaggggaccgcgcagccaccgccg
cccgggctgcagccgcacgcggagcccggcggctactcggggccggacggacattatgcc
atggacaatattaccaggcagaaccaattctacgatacccaagtcatcaaacaagaaaac
gagtcaggctacgagaggagaccactggaaatggagcagcagcaggcctatcgtccagaa
atgaagacagagatgaagcaaggagcacccaccagcttcctcccgcctgaagcttctcaa
ctcaagccagacaggcagcaattccagagtcgaaagaggccttatgaagaaaaccgggga
cgggggtactttgagcaccgagaggataggaggggccgctctcctcagcctcctgctgaa
gaggatgaagatgactttgatgatacccttgttgctattgacacctataactgcgacctc
cacttcaaggtggcccgagatcggagtagtggctatccgctcacaattgagggctttgca
tacctgtggtcaggagcccgtgccagctatggggtcagaaggggccgtgtatgcttcgag
atgaagatcaatgaggaaatctccgtgaagcaccttccgtctacagagcctgacccccac
gtggtccgtatcggctggtccctggactcctgcagcacccagctaggcgaagagcctttc
tcctatggctatggaggcactgggaagaagtccaccaatagccggtttgaaaactacgga
gacaagtttgcagagaacgatgtgattggctgctttgcggattttgaatgtggaaatgac
gtggaactgtcttttaccaagaatggaaagtggatgggcattgctttccgaatccagaag
gaagccttggggggtcaggccctctatcctcatgtcctggtgaagaattgcgcagtggag
ttcaacttcggacagagagcagagccctactgttctgtcctcccggggtttaccttcatc
cagcaccttccccttagtgagcgtatccggggcaccgttggaccaaagagcaaggcagaa
tgtgagattctgatgatggtgggcctgcctgctgctggcaagaccacatgggccatcaaa
catgcagcctccaacccttccaagaagtacaacatcctgggtaccaatgccatcatggat
aagatgcgggtgatgggcctacgccggcagcggaactatgctggccgctgggatgtcctg
atccagcaggccacccagtgcctcaaccgcctcatccagattgctgcccgcaagaaacgc
aactatatcctagatcagacaaatgtttatgggtcagcccagagacgaaaaatgagacca
tttgaaggcttccagcgcaaagctattgtaatttgtcccactgacgaggacctaaaagac
cgaacaataaagcgaaccgacgaggaagggaaggatgtcccagatcatgcggtcttagaa
atgaaagccaacttcacgttgccagatgttggggacttcctggatgaggttctgttcatt
gagctgcagcgggaggaagcggacaagctagtgaggcagtacaacgaggaaggccgcaag
gctgggccaccccctgaaaagcgctttgacaaccgaggtggtggtggcttccggggccgc
gggggtggtggtggcttccagcgctatgaaaaccgaggaccccctggaggcaaccgtggc
ggcttccagaaccgagggggaggcagcggtggaggaggcaactaccgaggaggtttcaac
cgcagcggaggtggtggctatagccagaaccgctggggtaacaacaaccgggataacaac
aactccaacaacagaggcagctacaaccgggctccccagcaacagccgccaccacagcag
cctccgccaccacagccaccaccccagcagccaccgccaccacccagctacagccctgct
cggaaccccccaggggccagcacctacaataagaacagcaacatccctggctcaagcgcc
aataccagcacccccaccgtcagcagctacagccctccacagccgagttacagccagcca
ccctacaaccagggaggttacagccagggctacacagccccaccgcctccacctccacca
ccacctgcctacaactatgggagctacggcggttacaacccggccccctataccccaccg
ccaccccccactgcacagacctaccctcagcccagctataaccagtatcagcagtatgcc
cagcagtggaaccagtactatcagaaccagggccagtggccgccatactacgggaactac
gactacgggagctactccgggaacacacagggtggcacaagtacacagtag

KEGG   Homo sapiens (human): 8480
Entry
8480              CDS       T01001                                 

Gene name
RAE1, Gle2, MIG14, MRNP41, Mnrp41, dJ481F12.3, dJ800J21.1
Definition
(RefSeq) ribonucleic acid export 1
  KO
K14298  mRNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
Network
nt06170  Influenza A virus (IAV)
  Element
N00746  IAV NS1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8480 (RAE1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    8480 (RAE1)
  09172 Infectious disease: viral
   05164 Influenza A
    8480 (RAE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    8480 (RAE1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8480 (RAE1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     8480 (RAE1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    8480 (RAE1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Exonuc_X-T_C
Other DBs
NCBI-GeneID: 8480
NCBI-ProteinID: NP_001015885
OMIM: 603343
HGNC: 9828
Ensembl: ENSG00000101146
Vega: OTTHUMG00000032819
Pharos: P78406(Tbio)
UniProt: P78406
LinkDB
Structure
PDB: 
3MMY 4OWR

Position
20q13.31
AA seq 368 aa
MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgagcctgtttggaacaacctcaggttttggaaccagtgggaccagcatgtttggcagt
gcaactacagacaatcacaatcccatgaaggatattgaagtaacatcatctcctgatgat
agcattggttgtctgtcttttagcccaccaaccttgccggggaactttcttattgcagga
tcatgggctaatgatgttcgctgctgggaagttcaagacagtggacagaccattccaaaa
gcccagcagatgcacactgggcctgtgcttgatgtctgctggagtgacgatgggagcaaa
gtgtttacggcatcgtgtgataaaactgccaaaatgtgggacctcagcagtaaccaagcg
atacagatcgcacagcatgatgctcctgttaaaaccatccattggatcaaagctccaaac
tacagctgtgtgatgactgggagctgggataagactttaaagttttgggatactcgatcg
tcaaatcctatgatggttttgcaactccctgaaaggtgttactgtgctgacgtgatatac
cccatggctgtggtggcaactgcagagaggggcctgattgtctatcagctagagaatcaa
ccttctgaattcaggaggatagaatctccactgaaacatcagcatcggtgtgtggctatt
tttaaagacaaacagaacaagcctactggttttgccctgggaagtatcgaggggagagtt
gctattcactatatcaaccccccgaaccccgccaaagataacttcacctttaaatgtcat
cgatctaatggaaccaacacttcagctcctcaggacatttatgcggtaaatggaatcgcg
ttccatcctgttcatggcacccttgcaactgtgggatctgatggtagattcagcttctgg
gacaaagatgccagaacaaaactaaaaacttcggaacagttagatcagcccatctcagct
tgctgtttcaatcacaatggaaacatatttgcatacgcttccagctacgactggtcaaag
ggacatgaattttataatccccagaaaaaaaattacattttcctgcgtaatgcagccgaa
gagctaaagcccaggaataagaagtag

DBGET integrated database retrieval system