KEGG   Homo sapiens (human): 10482Help
Entry
10482             CDS       T01001                                 

Gene name
NXF1, MEX67, TAP
Definition
(RefSeq) nuclear RNA export factor 1
  KO
K14284  nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
N00587  HSV ICP27 to Nuclear export of mRNA
N00746  IAV NS1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    10482 (NXF1)
   03015 mRNA surveillance pathway
    10482 (NXF1)
   03008 Ribosome biogenesis in eukaryotes
    10482 (NXF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    10482 (NXF1)
   05168 Herpes simplex virus 1 infection
    10482 (NXF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10482 (NXF1)
   03009 Ribosome biogenesis [BR:hsa03009]
    10482 (NXF1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     10482 (NXF1)
   mRNA cycle factors
    Stress granule specific factors
     10482 (NXF1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    10482 (NXF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_4 LRR_8 LRR_9
Motif
Other DBs
NCBI-GeneID: 10482
NCBI-ProteinID: NP_006353
OMIM: 602647
HGNC: 8071
Ensembl: ENSG00000162231
Vega: OTTHUMG00000167612
Pharos: Q9UBU9(Tbio)
UniProt: Q9UBU9
LinkDB All DBs
Structure
PDB: 

Position
11q12.3
AA seq 619 aa AA seqDB search
MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVA
MSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
KITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKIL
DRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVA
QNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG
NELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPI
AFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFV
VDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNAS
SEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSA
QAFTHLKAKGEIPEVAFMK
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggggaagtcgtacagcgaacacgatgatgaacgcgttaatttccctcaa
agaaagaagaaaggccggggtcccttccggtggaaatatggtgaaggaaaccgtaggtct
ggaagaggcggttctggtattcggtcttcccgccttgaggaagatgatggagatgtggca
atgagtgatgcccaggatggtccccgagtacgatacaacccctataccacccgacctaac
cgtcggggtgatacttggcatgatcgagatcgcattcatgttactgtgcggagagacaga
gctcctccagagagaggaggggctggcaccagccaggatgggacctcaaagaactggttc
aagattacaattccttatggcagaaagtatgacaaggcatggctcctgagcatgattcag
agcaagtgcagtgtgcccttcacccctattgagtttcactatgagaatacacgggcccag
ttcttcgttgaagacgccagtactgcctctgcattgaaggctgtcaactataagattttg
gatcgggagaaccgaaggatatctatcatcatcaactcttctgctccaccccacactata
ctgaatgaactgaagccagaacaagtagaacagctaaagctgatcatgagcaaacgatac
gatggctcccaacaagcccttgacctcaaaggcctccgttcagacccagatttggtggcc
cagaacattgacgttgtcctgaatcgcagaagctgtatggcagctaccctgaggatcatt
gaagagaacatccctgagctattgtccttgaacttgagcaacaacaggctgtacaggctg
gatgacatgtctagcattgttcagaaggcacccaacctgaagatcctaaacctttctgga
aatgaattgaagtctgagcgggaattggacaagataaaggggctgaagctagaagagctc
tggctcgatggaaactccctgtgtgacaccttccgagaccagtccacctacatcagcgcc
attcgcgaacgatttcccaagttactacgcctggatggccatgagctacccccaccaatt
gcctttgatgttgaagcccccacgacgttaccgccctgcaagggaagctattttggaaca
gaaaacttgaagagtctggtcttgcacttcctgcaacagtactatgcaatttacgactct
ggagaccgacaagggctcctggatgcctaccatgatggggcctgctgttccctgagcatt
cctttcattcctcagaaccctgcccgaagcagcttagccgagtatttcaaggatagcaga
aatgtgaagaagcttaaagaccctaccttgcggttccggctgctgaagcacacgcgtctc
aacgttgttgccttcctcaatgagttgcccaaaacccagcacgacgtcaattccttcgtg
gtagacataagcgcccagacaagcacattgctgtgtttttctgtcaatggagtcttcaag
gaagtggacggaaagtcccgggattctttgcgagccttcacccggacattcattgctgtt
cctgctagcaattcagggctatgtattgtaaatgatgagctatttgtgcggaatgccagt
tctgaagagatccaaagagccttcgctatgcctgcacccacgccttcctccagcccggtg
cccaccctctctccagagcagcaggaaatgttgcaagcattctctacccagtctggcatg
aacctcgagtggtcccagaagtgccttcaggacaacaactgggactacaccagatctgcc
caggccttcactcatctcaaggccaagggcgagatcccagaagtggcattcatgaagtga

KEGG   Homo sapiens (human): 55998Help
Entry
55998             CDS       T01001                                 

Gene name
NXF5
Definition
(RefSeq) nuclear RNA export factor 5
  KO
K14284  nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    55998 (NXF5)
   03015 mRNA surveillance pathway
    55998 (NXF5)
   03008 Ribosome biogenesis in eukaryotes
    55998 (NXF5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    55998 (NXF5)
   05168 Herpes simplex virus 1 infection
    55998 (NXF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    55998 (NXF5)
   03009 Ribosome biogenesis [BR:hsa03009]
    55998 (NXF5)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     55998 (NXF5)
   mRNA cycle factors
    Stress granule specific factors
     55998 (NXF5)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    55998 (NXF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tap-RNA_bind LRR_4 LRR_8
Motif
Other DBs
NCBI-GeneID: 55998
NCBI-ProteinID: NP_116564
OMIM: 300319
HGNC: 8075
Ensembl: ENSG00000126952
Vega: OTTHUMG00000022042
Pharos: Q9H1B4(Tdark)
UniProt: Q9H1B4
LinkDB All DBs
Position
Xq22.1
AA seq 365 aa AA seqDB search
MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVA
SAASALKDVSYKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQA
LDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDI
TEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFP
KLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQSNLCKYFKDSRNI
KILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQ
SLRPL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggaacacacaagatgaaaacatgaggaaatggttcaaggtcacaattccttat
gggataaagtatgacaaggcatggctaatgaattcaatccagagcaattgcagtgtcccc
ttcactccggttgatttccactacatccgaaatcgggcatgcttctttgtccaggttgct
agtgctgcctctgcattgaaggatgtcagttataagatttatgatgatgagaaccaaaag
atatgtatatttgtcagtcattttactgcgccctactctgtgaagaataagttgaagcca
ggccaaatggagatgctaaagctgaccatgaacaaacggtacaatgtctcccagcaagct
cttgatctccagaatctccgctttgacccagacttgatgggccgtgacattgatataatc
ctgaatcgaagaaactgcatggctgccaccctgaagatcactgaaagaaatttccctgag
ctgttgtctttgaacttgtgcaacaacaaactgtaccagctggatggcctttctgacatt
acagagaaggctcccaaagtcaagaccctgaatctctccaaaaataagctggagtcggcg
tgggagttgggcaaggtgaaagggctgaagctcgaagagctatggctagaagggaacccg
ttgtgcagcaccttctcggaccagtctgcctatgtaagtgccatccgggattgtttcccc
aagttgttacgcctggacggccgagagttatccgcaccagtgattgttgacattgacagc
tctgagacaatgaaaccctgcaaggaaaactttactggatctgagaccctaaagcattta
gtcctgcaattcctgcagcagagcaacttgtgcaagtacttcaaggatagcaggaatata
aaaattctcaaagacccctacctgcagaggaagctgctaaagcacacaaaatgtccacga
aacgtggactccctcagtgcattgcctgaaactcagcatgacttcacctccatcctggtg
gacatgtggtaccagaccgtgaacacctgcttcctccctcgggcaggcccagagagccag
agcctaagaccactctaa

KEGG   Homo sapiens (human): 56000Help
Entry
56000             CDS       T01001                                 

Gene name
NXF3
Definition
(RefSeq) nuclear RNA export factor 3
  KO
K14284  nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    56000 (NXF3)
   03015 mRNA surveillance pathway
    56000 (NXF3)
   03008 Ribosome biogenesis in eukaryotes
    56000 (NXF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    56000 (NXF3)
   05168 Herpes simplex virus 1 infection
    56000 (NXF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    56000 (NXF3)
   03009 Ribosome biogenesis [BR:hsa03009]
    56000 (NXF3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     56000 (NXF3)
   mRNA cycle factors
    Stress granule specific factors
     56000 (NXF3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    56000 (NXF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tap-RNA_bind NTF2
Motif
Other DBs
NCBI-GeneID: 56000
NCBI-ProteinID: NP_071335
OMIM: 300316
HGNC: 8073
Ensembl: ENSG00000147206
Vega: OTTHUMG00000022088
Pharos: Q9H4D5(Tbio)
UniProt: Q9H4D5
LinkDB All DBs
Position
Xq22.1
AA seq 531 aa AA seqDB search
MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHM
DSPVRYTPYTISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKITVPF
GIKYNEKWLLNLIQNECSVPFVPVEFHYENMHASFFVENASIAYALKNVSGKIWDEDNEK
ISIFVNPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMA
SNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNINSIL
ELFPKLLCLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQQYYLIYDSGD
RQGLLSAYHDEACFSLSIPFNPEDSAPSSFCKFFKDSRNIKILKDPYLRGELLKHTKLDI
VDSLSALPKTQHDLSSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPG
SSSSLCIVNDKLFVRDTSHQGTQSALFTLVPTAFSSSVPAFSQEQQKMLPS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgccttcaggacacactacgggtcacactgatcaagttgttcaaagaagagca
agatgttgggatatttaccaaaggagatttagcagtaggtctgaacctgtcaatcctggc
atgcattcttcatcccatcagcagcaagatggagatgcagcaatgcatggtgcccacatg
gactctccagtaagatacactccctatactatttcaccctataatcggaaaggcagtttt
cgtaaacaagaccaaacccacgttaacatggagagagagcaaaaacctccagagagaaga
atggaggggaacatgccggatgggaccttagggagctggttcaagatcacagttcccttt
ggcataaaatacaatgagaagtggctgctgaatttgattcagaatgaatgcagtgtaccc
ttcgtcccagttgagtttcactatgaaaacatgcatgccagcttctttgtggagaatgcc
agcatcgcctatgcactgaagaatgtcagtggcaagatttgggatgaggataatgaaaag
atatcaatctttgtcaaccctgctggcataccccactttgtgcacagggagctgaagtca
gaaaaggtggagcagataaagctggccatgaaccaacagtgtgatgtctcccaggaagct
cttgatatccagagactcccattttacccagacatggtgaaccgtgatactaagatggca
tcgaatcctagaaagtgcatggctgcctccctggacgtccatgaagagaacatacctaca
gtgatgtctgcaggggagatggacaagtggaaagggatagagccaggagagaagtgtgcg
gacagaagcccagtgtgcacgaccttctcggatacctccagcaacataaactccatcctg
gaattgttccccaaattattatgcctggatggccagcagtcacccagagcaactttatgt
ggtactgaagcccacaagaggttaccaacctgtaagggaagcttctttggatctgagatg
ttgaagaatctggtcctgcaattcctgcagcagtattacttgatctatgactctggagat
cgacagggtctccttagtgcttaccacgatgaggcctgcttctccctgagcattcccttc
aatcctgaggactcagccccgagcagcttctgcaagttcttcaaggatagcaggaatata
aaaattctcaaggacccctaccttcggggggagctgctgaagcacacaaaacttgatatt
gtggactccctcagtgcgttgcctaaaactcagcatgacctcagctccttcctggtggac
atgtggtaccagacggaatggatgctctgcttttctgtcaacggggtgttcaaggaagtg
gaaggacagtctcagggttctgttctcgccttcacccggaccttcattgctacccctggc
agcagttccagtctgtgcatcgtgaatgacaagctctttgtgcgggataccagccaccaa
gggacccagagtgccttgttcaccctagtgcccacagccttctccagctccgtgcctgcc
ttctcccaggagcagcagaaaatgctgccttcgtaa

KEGG   Homo sapiens (human): 56001Help
Entry
56001             CDS       T01001                                 

Gene name
NXF2, CT39, TAPL-2, TCP11X2
Definition
(RefSeq) nuclear RNA export factor 2
  KO
K14284  nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    56001 (NXF2)
   03015 mRNA surveillance pathway
    56001 (NXF2)
   03008 Ribosome biogenesis in eukaryotes
    56001 (NXF2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    56001 (NXF2)
   05168 Herpes simplex virus 1 infection
    56001 (NXF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    56001 (NXF2)
   03009 Ribosome biogenesis [BR:hsa03009]
    56001 (NXF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     56001 (NXF2)
   mRNA cycle factors
    Stress granule specific factors
     56001 (NXF2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    56001 (NXF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_4 LRR_8
Motif
Other DBs
NCBI-GeneID: 56001
NCBI-ProteinID: NP_071336
OMIM: 300315
HGNC: 8072
Ensembl: ENSG00000269405
Vega: OTTHUMG00000189320
UniProt: Q9GZY0
LinkDB All DBs
Position
Xq22.1
AA seq 626 aa AA seqDB search
MCSTLKKCGTYRTEVAECHDHGSTFQGRKKGGSSFRDNFDKRSCHYEHGGYERPPSHCQE
NDGSVEMRDVHKDQQLRHTPYSIRCERRMKWHSEDEIRITTWRNRKPPERKMSQNTQDGY
TRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACFFVQDASAASALKDV
SYKIYDDENQKICIFVNHSTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFD
PDLMGRDIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKT
LNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRE
LSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEAC
FSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHD
LSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDELF
VRDASPQETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQKCLQDNEWN
YTRAGQAFTMLQTEGKIPAEAFKQIS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgctctactctaaagaagtgtgggacatacagaactgaagttgcagaatgccatgac
catggtagcacttttcaaggaagaaagaaaggtgggagttctttccgggataattttgac
aagaggagctgtcattatgaacatggtgggtatgagcgcccgccttcacactgccaggag
aatgatggaagcgtggagatgagggatgtccacaaggaccaacaactaagacacactcct
tatagcatccgatgcgaaagaagaatgaaatggcatagtgaagacgaaatccgtattacc
acgtggagaaatagaaaacctccggagagaaaaatgagtcagaacacacaggatggatac
acaaggaactggtttaaggtcacaattccttacgggataaagtatgacaaggcatggcta
atgaattcaatccagagccattgcagtgaccgcttcactccggttgatttccactacgtc
cgaaatcgggcatgcttctttgtccaggatgctagcgctgcctccgcattgaaggatgtc
agttataagatttatgatgatgagaaccaaaagatatgtatatttgtcaatcattctact
gcgccctactctgtgaagaataagttgaagccaggccaaatggagatgctaaagctgacc
atgaacaaacggtacaatgtctcccagcaagctcttgatctccagaatctccgctttgac
ccagacttgatgggccgtgacattgatataatcctgaatcgaagaaactgcatggctgcc
accctgaagatcattgaaagaaatttccctgagctgttgtctttgaacttgtgcaacaac
aagctgtaccagctggatggcctttctgacattacagagaaggctcccaaagtcaagacc
ctgaatctctccaaaaataagctggagtcggcgtgggagttgggcaaggtgaaagggctg
aagctcgaagagctatggctagaagggaacccgttgtgcagcaccttctcggaccagtcc
gcctatgtaagtgccatccgggattgtttccccaagttgttacgcctggacggccgagag
ttatccgcaccagtgattgttgacattgacagctctgagacaatgaaaccctgcaaggaa
aactttactggatctgagaccctaaagcatttagtcctgcaattcctgcagcagtattac
tcgatctatgactctggagatcgacagggtctcctcggtgcttaccacgatgaggcctgc
ttctccttggctattcccttcgaccccaaggactcagccccgagcagcttgtgcaagtac
tttgaggatagcaggaatatgaaaacactcaaggacccctacctgaagggggaactgctg
aggcgcacaaaacgtgacattgtggactccctcagtgcgttgcccaaaactcagcatgac
ctcagctccatcctggtggacgtgtggtgccagacggaaaggatgctctgcttttctgtc
aatggggttttcaaggaagtggaaggacagtctcagggttctgttctcgccttcacccgg
accttcattgctacccctggcagcagttccagtctgtgcatcgtgaatgacgagctgttt
gtgagggatgccagcccccaagagactcagagtgccttctccatcccagtgtccacactc
tcctccagctctgagccctccctctcccaggagcagcaggaaatggtgcaggctttctct
gcccagtctgggatgaaactggagtggtctcagaagtgccttcaggacaatgagtggaac
tacactagagctggccaggccttcactatgctccagaccgagggcaagatccccgcggag
gccttcaagcaaatctcctaa

KEGG   Homo sapiens (human): 728343Help
Entry
728343            CDS       T01001                                 

Gene name
NXF2B, TCP11X2, bA353J17.1
Definition
(RefSeq) nuclear RNA export factor 2B
  KO
K14284  nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    728343 (NXF2B)
   03015 mRNA surveillance pathway
    728343 (NXF2B)
   03008 Ribosome biogenesis in eukaryotes
    728343 (NXF2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    728343 (NXF2B)
   05168 Herpes simplex virus 1 infection
    728343 (NXF2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    728343 (NXF2B)
   03009 Ribosome biogenesis [BR:hsa03009]
    728343 (NXF2B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     728343 (NXF2B)
   mRNA cycle factors
    Stress granule specific factors
     728343 (NXF2B)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    728343 (NXF2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_4 LRR_8
Motif
Other DBs
NCBI-GeneID: 728343
NCBI-ProteinID: NP_001093156
HGNC: 23984
Ensembl: ENSG00000269437
Vega: OTTHUMG00000154920
Pharos: Q9GZY0(Tdark)
UniProt: Q9GZY0
LinkDB All DBs
Position
Xq22.1
AA seq 626 aa AA seqDB search
MCSTLKKCGTYRTEVAECHDHGSTFQGRKKGGSSFRDNFDKRSCHYEHGGYERPPSHCQE
NDGSVEMRDVHKDQQLRHTPYSIRCERRMKWHSEDEIRITTWRNRKPPERKMSQNTQDGY
TRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACFFVQDASAASALKDV
SYKIYDDENQKICIFVNHSTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFD
PDLMGRDIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKT
LNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRE
LSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEAC
FSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHD
LSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDELF
VRDASPQETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQKCLQDNEWN
YTRAGQAFTMLQTEGKIPAEAFKQIS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgctctactctaaagaagtgtgggacatacagaactgaagttgcagaatgccatgac
catggtagcacttttcaaggaagaaagaaaggtgggagttctttccgggataattttgac
aagaggagctgtcattatgaacatggtgggtatgagcgcccgccttcacactgccaggag
aatgatggaagcgtggagatgagggatgtccacaaggaccaacaactaagacacactcct
tatagcatccgatgcgaaagaagaatgaaatggcatagtgaagacgaaatccgtattacc
acgtggagaaatagaaaacctccggagagaaaaatgagtcagaacacacaggatggatac
acaaggaactggtttaaggtcacaattccttacgggataaagtatgacaaggcatggcta
atgaattcaatccagagccattgcagtgaccgcttcactccggttgatttccactacgtc
cgaaatcgggcatgcttctttgtccaggatgctagcgctgcctccgcattgaaggatgtc
agttataagatttatgatgatgagaaccaaaagatatgtatatttgtcaatcattctact
gcgccctactctgtgaagaataagttgaagccaggccaaatggagatgctaaagctgacc
atgaacaaacggtacaatgtctcccagcaagctcttgatctccagaatctccgctttgac
ccagacttgatgggccgtgacattgatataatcctgaatcgaagaaactgcatggctgcc
accctgaagatcattgaaagaaatttccctgagctgttgtctttgaacttgtgcaacaac
aagctgtaccagctggatggcctttctgacattacagagaaggctcccaaagtcaagacc
ctgaatctctccaaaaataagctggagtcggcgtgggagttgggcaaggtgaaagggctg
aagctcgaagagctatggctagaagggaacccgttgtgcagcaccttctcggaccagtcc
gcctatgtaagtgccatccgggattgtttccccaagttgttacgcctggacggccgagag
ttatccgcaccagtgattgttgacattgacagctctgagacaatgaaaccctgcaaggaa
aactttactggatctgagaccctaaagcatttagtcctgcaattcctgcagcagtattac
tcgatctatgactctggagatcgacagggtctcctcggtgcttaccacgatgaggcctgc
ttctccttggctattcccttcgaccccaaggactcagccccgagcagcttgtgcaagtac
tttgaggatagcaggaatatgaaaacactcaaggacccctacctgaagggggaactgctg
aggcgcacaaaacgtgacattgtggactccctcagtgcgttgcccaaaactcagcatgac
ctcagctccatcctggtggacgtgtggtgccagacggaaaggatgctctgcttttctgtc
aatggggttttcaaggaagtggaaggacagtctcagggttctgttctcgccttcacccgg
accttcattgctacccctggcagcagttccagtctgtgcatcgtgaatgacgagctgttt
gtgagggatgccagcccccaagagactcagagtgccttctccatcccagtgtccacactc
tcctccagctctgagccctccctctcccaggagcagcaggaaatggtgcaggctttctct
gcccagtctgggatgaaactggagtggtctcagaagtgccttcaggacaatgagtggaac
tacactagagctggccaggccttcactatgctccagaccgagggcaagatccccgcggag
gccttcaagcaaatctcctaa

DBGET integrated database retrieval system