KEGG   Homo sapiens (human): 1050Help
Entry
1050              CDS       T01001                                 

Gene name
CEBPA, C/EBP-alpha, CEBP
Definition
(RefSeq) CCAAT enhancer binding protein alpha
  KO
K09055  CCAAT/enhancer binding protein (C/EBP), alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00111  AML1-ETO fusion to CEBPA-mediated transcription
Disease
H00003  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1050 (CEBPA)
   05202 Transcriptional misregulation in cancer
    1050 (CEBPA)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1050 (CEBPA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1050 (CEBPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1050 (CEBPA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1050 (CEBPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 TolA_bind_tri bZIP_Maf Lipoprotein_20 Nup54 DivIC Hema_stalk DUF2514
Motif
Other DBs
NCBI-GeneID: 1050
NCBI-ProteinID: NP_004355
OMIM: 116897
HGNC: 1833
Ensembl: ENSG00000245848
Vega: OTTHUMG00000161461
Pharos: P49715(Tbio)
UniProt: P49715
LinkDB All DBs
Position
19q13.11
AA seq 358 aa AA seqDB search
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM
PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP
YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA
LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggccgacttctacgaggcggagccgcggcccccgatgagcagccacctgcag
agccccccgcacgcgcccagcagcgccgccttcggctttccccggggcgcgggccccgcg
cagcctcccgccccacctgccgccccggagccgctgggcggcatctgcgagcacgagacg
tccatcgacatcagcgcctacatcgacccggccgccttcaacgacgagttcctggccgac
ctgttccagcacagccggcagcaggagaaggccaaggcggccgtgggccccacgggcggc
ggcggcggcggcgactttgactacccgggcgcgcccgcgggccccggcggcgccgtcatg
cccgggggagcgcacgggcccccgcccggctacggctgcgcggccgccggctacctggac
ggcaggctggagcccctgtacgagcgcgtcggggcgccggcgctgcggccgctggtgatc
aagcaggagccccgcgaggaggatgaagccaagcagctggcgctggccggcctcttccct
taccagccgccgccgccgccgccgccctcgcacccgcacccgcacccgccgcccgcgcac
ctggccgccccgcacctgcagttccagatcgcgcactgcggccagaccaccatgcacctg
cagcccggtcaccccacgccgccgcccacgcccgtgcccagcccgcaccccgcgcccgcg
ctcggtgccgccggcctgccgggccctggcagcgcgctcaaggggctgggcgccgcgcac
cccgacctccgcgcgagtggcggcagcggcgcgggcaaggccaagaagtcggtggacaag
aacagcaacgagtaccgggtgcggcgcgagcgcaacaacatcgcggtgcgcaagagccgc
gacaaggccaagcagcgcaacgtggagacgcagcagaaggtgctggagctgaccagtgac
aatgaccgcctgcgcaagcgggtggaacagctgagccgcgaactggacacgctgcggggc
atcttccgccagctgccagagagctccttggtcaaggccatgggcaactgcgcgtga

DBGET integrated database retrieval system