KEGG   Homo sapiens (human): 1053Help
Entry
1053              CDS       T01001                                 

Gene name
CEBPE, C/EBP-epsilon, CRP1
Definition
(RefSeq) CCAAT enhancer binding protein epsilon
  KO
K10051  CCAAT/enhancer binding protein (C/EBP), epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00113  PML-RARA fusion to transcriptional repression
Disease
H00101  Other phagocyte defects
H02024  Neutrophil specific granule deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1053 (CEBPE)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1053 (CEBPE)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1053 (CEBPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 Taxilin Nmad5 UPF0449 Fib_alpha DUF2514 DUF2605 SBE2
Motif
Other DBs
NCBI-GeneID: 1053
NCBI-ProteinID: NP_001796
OMIM: 600749
HGNC: 1836
Ensembl: ENSG00000092067
Vega: OTTHUMG00000028719
Pharos: Q15744(Tbio)
UniProt: Q15744
LinkDB All DBs
Position
14q11.2
AA seq 281 aa AA seqDB search
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV
KPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAV
KEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPC
SPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM
AENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacgggacctactacgagtgtgagccccggggtggccagcagccactcgagttc
tcagggggccgagctgggcccggggagctaggggacatgtgtgagcatgaggcctccatt
gacctctccgcctacatcgagtctggggaagagcagcttctctccgatctctttgccgtg
aagccagcgcctgaggccagaggcctcaagggccccggaacccctgccttcccccactac
ttgccgcctgaccctcggccctttgcctaccctccacataccttcggcccagacaggaag
gcgctggggcctggcatctacagcagcccagggagctacgaccccagggctgtggcggtg
aaggaggagccccgggggccagagggcagccgagctgccagccgaggcagctacaatccc
ctgcagtaccaagtggcacactgtgggcagacagccatgcacctgcccccaactctggca
gcacccggccagcctctgcgcgttctcaaggcccctttggccactgccgcacccccctgc
agtcccctcctgaaggcgccctccccggctggccccttacacaagggcaagaaggcagtg
aacaaagatagccttgagtaccggctgaggcgggagcgcaacaacatcgccgtgcgcaag
agccgagacaaggccaagaggcgcattctggagacgcagcagaaggtgctggagtacatg
gcagagaacgagcgcctccgcagccgcgtggagcagctcacccaggagctagacaccctc
cgcaacctcttccgccagattcctgaggcggccaacctcatcaagggcgtggggggttgc
agctga

KEGG   Homo sapiens (human): 597Help
Entry
597               CDS       T01001                                 

Gene name
BCL2A1, ACC-1, ACC-2, ACC1, ACC2, BCL2L5, BFL1, GRS, HBPA1
Definition
(RefSeq) BCL2 related protein A1
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00113  PML-RARA fusion to transcriptional repression
N00123  Amplified REL to transcription
Drug target
Navitoclax: D09935
Navitoclax dihydrochloride: D09936
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    597 (BCL2A1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    597 (BCL2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    597 (BCL2A1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    597 (BCL2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 DDE_Tnp_1_assoc CCDC24
Motif
Other DBs
NCBI-GeneID: 597
NCBI-ProteinID: NP_004040
OMIM: 601056
HGNC: 991
Ensembl: ENSG00000140379
Vega: OTTHUMG00000144173
Pharos: Q16548(Tchem)
UniProt: Q16548
LinkDB All DBs
Structure
PDB: 

Position
15q25.1
AA seq 175 aa AA seqDB search
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacagactgtgaatttggatatatttacaggctggctcaggactatctgcagtgcgtc
ctacagataccacaacctggatcaggtccaagcaaaacgtccagagtgctacaaaatgtt
gcgttctcagtccaaaaagaagtggaaaagaatctgaagtcatgcttggacaatgttaat
gttgtgtccgtagacactgccagaacactattcaaccaagtgatggaaaaggagtttgaa
gacggcatcattaactggggaagaattgtaaccatatttgcatttgaaggtattctcatc
aagaaacttctacgacagcaaattgccccggatgtggatacctataaggagatttcatat
tttgttgcggagttcataatgaataacacaggagaatggataaggcaaaacggaggctgg
gaaaatggctttgtaaagaagtttgaacctaaatctggctggatgacttttctagaagtt
acaggaaagatctgtgaaatgctatctctcctgaagcaatactgttga

DBGET integrated database retrieval system