KEGG   Homo sapiens (human): 10538
Entry
10538             CDS       T01001                                 

Gene name
BATF, B-ATF, BATF1, SFA-2, SFA2
Definition
(RefSeq) basic leucine zipper ATF-like transcription factor
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    10538 (BATF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10538 (BATF)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    10538 (BATF)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Phlebovirus_NSM Sec34 TMCO5 AAA_11 DUF3450 Atg14 HALZ Seryl_tRNA_N CtIP_N TMPIT
Other DBs
NCBI-GeneID: 10538
NCBI-ProteinID: NP_006390
OMIM: 612476
HGNC: 958
Ensembl: ENSG00000156127
Vega: OTTHUMG00000171486
Pharos: Q16520(Tbio)
UniProt: Q16520
LinkDB
Position
14q24.3
AA seq 125 aa
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSS
PRFQP
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcctcacagctccgacagcagtgactccagcttcagccgctctcctccccctggcaaa
caggactcatctgatgatgtgagaagagttcagaggagggagaaaaatcgtattgccgcc
cagaagagccgacagaggcagacacagaaggccgacaccctgcacctggagagcgaagac
ctggagaaacagaacgcggctctacgcaaggagatcaagcagctcacagaggaactgaag
tacttcacgtcggtgctgaacagccacgagcccctgtgctcggtgctggccgccagcacg
ccctcgccccccgaggtggtgtacagcgcccacgcattccaccaacctcatgtcagctcc
ccgcgcttccagccctga

KEGG   Homo sapiens (human): 116071
Entry
116071            CDS       T01001                                 

Gene name
BATF2, SARI
Definition
(RefSeq) basic leucine zipper ATF-like transcription factor 2
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116071 (BATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    116071 (BATF2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    116071 (BATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HALZ HAP1_N DUF3287
Other DBs
NCBI-GeneID: 116071
NCBI-ProteinID: NP_612465
OMIM: 614983
HGNC: 25163
Ensembl: ENSG00000168062
Vega: OTTHUMG00000165633
Pharos: Q8N1L9(Tbio)
UniProt: Q8N1L9
LinkDB
Position
11q13.1
AA seq 274 aa
MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALR
KEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQ
LELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASH
TGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREH
KPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcacctctgtgggggcaatgggctgctgacccagacagaccccaaggagcaacaaagg
cagctgaagaagcagaagaaccgggcagccgcccagcgaagccggcagaagcacacagac
aaggcagacgccctgcaccagcagcacgagtctctggaaaaagacaacctcgccctgcgg
aaggagatccagtccctgcaggccgagctggcgtggtggagccggaccctgcacgtgcat
gagcgcctgtgccccatggattgtgcctcctgctcagctccagggctcctgggctgctgg
gaccaggctgaggggctcctgggccctggcccacagggacaacatggctgccgggagcag
ctggagctgttccagaccccgggttcctgttacccagctcagccgctctctccaggtcca
cagcctcatgattctcccagcctcctccagtgccccctgccctcactgtcccttggcccc
gctgtggttgctgaacctcctgtccagctgtcccccagccctctcctgtttgcctcgcac
actggttccagcctgcaggggtcttcctctaagctcagtgccctccagcccagcctcacg
gcccaaactgcccctccacagcccctcgagctggagcatcccaccagagggaagctgggg
tcctctcccgacaacccttcctctgccctggggcttgcacgtctgcagagcagggagcac
aaacctgctctctcagcagccacttggcaagggctggttgtggatcccagccctcaccct
ctcctggcctttcctctgctctcctctgctcaagtccacttctaa

KEGG   Homo sapiens (human): 55509
Entry
55509             CDS       T01001                                 

Gene name
BATF3, JDP1, JUNDM1, SNFT
Definition
(RefSeq) basic leucine zipper ATF-like transcription factor 3
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    55509 (BATF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    55509 (BATF3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    55509 (BATF3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HALZ HAUS-augmin3 ATG16 HAP1_N AbiGi Ribosomal_L30_N DUF812 CENP-H DUF3450 DivIC DUF16 UPF0242 TMF_DNA_bd Prominin TMCO5 Cnn_1N HlyD_2 ZapB Uso1_p115_C DUF2205 Baculo_gp64 DUF4407 WDCP FapA
Other DBs
NCBI-GeneID: 55509
NCBI-ProteinID: NP_061134
OMIM: 612470
HGNC: 28915
Ensembl: ENSG00000123685
Vega: OTTHUMG00000036807
Pharos: Q9NR55(Tdark)
UniProt: Q9NR55
LinkDB
Position
1q32.3
AA seq 127 aa
MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKA
DKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDP
VAGCLPR
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtcgcaagggctcccggccgccggcagcgtcctgcagaggagcgtcgcggcgcccggg
aaccagccgcagccgcagccgcagcagcagagccctgaggatgatgacaggaaggtccga
aggagagaaaaaaaccgagttgctgctcagagaagtcggaagaagcagacccagaaggct
gacaagctccatgaggaatatgagagcctggagcaagaaaacaccatgctgcggagagag
atcgggaagctgacagaggagctgaagcacctgacagaggcactgaaggagcacgagaag
atgtgcccgctgctgctctgccctatgaactttgtgccagtgcctccccggccggaccct
gtggccggctgcttgccccgatga

DBGET integrated database retrieval system