KEGG   Homo sapiens (human): 10540
Entry
10540             CDS       T01001                                 

Gene name
DCTN2, DCTN50, DYNAMITIN, HEL-S-77, RBP50
Definition
(RefSeq) dynactin subunit 2
  KO
K10424  dynactin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    10540 (DCTN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10540 (DCTN2)
   05016 Huntington disease
    10540 (DCTN2)
   05022 Pathways of neurodegeneration - multiple diseases
    10540 (DCTN2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10540 (DCTN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10540 (DCTN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10540 (DCTN2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     10540 (DCTN2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     10540 (DCTN2)
SSDB
Motif
Pfam: Dynamitin ALIX_LYPXL_bnd PI_PP_I Fam20C ZapB PRD
Other DBs
NCBI-GeneID: 10540
NCBI-ProteinID: NP_001248342
OMIM: 607376
HGNC: 2712
Ensembl: ENSG00000175203
Vega: OTTHUMG00000170124
Pharos: Q13561(Tbio)
UniProt: Q13561 A0A384MDU9
LinkDB
Position
12q13.3
AA seq 401 aa
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDK
RVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKI
KTTVKESATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQ
LEATKNSKGGSGGKTTGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRC
DQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASV
EDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMI
ANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgaccttcccggcattgccaggaatgagccagatgtttat
gaaactagcgacctacctgaggatgatcaagcggagttcgatgcggaggagctgacaagc
acaagtgtggaacacatcattgtcaatcctaatgctgcctatgacaagttcaaggacaag
agagtggggacaaagggacttgatttctcagatcgtattggaaaaaccaagaggacagga
tatgaatctggagaatatgagatgcttggagagggtctgggagtgaaggagacaccccag
caaaagtaccagcgcctactgcatgaggtccaagagctgacaactgaagttgaaaaaatc
aagacgacagtgaaggagtcagccacagaggagaagctgacccctgtgttgctggctaaa
cagctggcagccctgaagcagcagctggttgcttcccacctggagaagctgctgggacca
gatgctgcaatcaaccttaccgaccccgatggcgccctggctaagcgcctactactgcag
ctggaagcaacaaagaacagcaaagggggatcagggggaaaaaccactgggaccccccca
gatagcagccttgtcacttatgaactacattctcggcctgagcaggacaagttctctcaa
gctgccaaagtcgcagaacttgaaaagcgcctgacagagctggagacagctgtacgttgt
gatcaggatgctcagaatcccctttctgcaggtctacagggagcctgtctcatggagact
gtagagctgttgcaagcaaaggtgagcgccctagaccttgcagttttggatcaagtggag
gctcggctacagagtgtcctgggaaaggtgaacgagattgccaagcataaagcctctgta
gaagatgcagatacacaaagcaaggtgcaccagctatatgaaactatacagcgctggagc
cccattgcctccaccctccctgagctggtgcagagacttgtcaccatcaagcagctgcac
gagcaagccatgcagtttggtcagctcctgacacacttggataccacccagcagatgatt
gctaattccttgaaggacaataccaccctcttgacccaggtgcagacaaccatgcgtgaa
aacctggccacagttgaggggaactttgccagcattgatgaacggatgaagaagctggga
aagtga

DBGET integrated database retrieval system