KEGG   Homo sapiens (human): 10540
Entry
10540             CDS       T01001                                 

Gene name
DCTN2, DCTN50, DYNAMITIN, HEL-S-77, RBP50
Definition
(RefSeq) dynactin subunit 2
  KO
K10424  dynactin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    10540 (DCTN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10540 (DCTN2)
   05016 Huntington disease
    10540 (DCTN2)
   05022 Pathways of neurodegeneration - multiple diseases
    10540 (DCTN2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10540 (DCTN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10540 (DCTN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10540 (DCTN2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     10540 (DCTN2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     10540 (DCTN2)
SSDB
Motif
Pfam: Dynamitin ALIX_LYPXL_bnd PI_PP_I Fam20C ZapB PRD
Other DBs
NCBI-GeneID: 10540
NCBI-ProteinID: NP_001248342
OMIM: 607376
HGNC: 2712
Ensembl: ENSG00000175203
Vega: OTTHUMG00000170124
Pharos: Q13561(Tbio)
UniProt: Q13561 A0A384MDU9
LinkDB
Position
12q13.3
AA seq 401 aa
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDK
RVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKI
KTTVKESATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQ
LEATKNSKGGSGGKTTGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRC
DQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASV
EDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMI
ANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgaccttcccggcattgccaggaatgagccagatgtttat
gaaactagcgacctacctgaggatgatcaagcggagttcgatgcggaggagctgacaagc
acaagtgtggaacacatcattgtcaatcctaatgctgcctatgacaagttcaaggacaag
agagtggggacaaagggacttgatttctcagatcgtattggaaaaaccaagaggacagga
tatgaatctggagaatatgagatgcttggagagggtctgggagtgaaggagacaccccag
caaaagtaccagcgcctactgcatgaggtccaagagctgacaactgaagttgaaaaaatc
aagacgacagtgaaggagtcagccacagaggagaagctgacccctgtgttgctggctaaa
cagctggcagccctgaagcagcagctggttgcttcccacctggagaagctgctgggacca
gatgctgcaatcaaccttaccgaccccgatggcgccctggctaagcgcctactactgcag
ctggaagcaacaaagaacagcaaagggggatcagggggaaaaaccactgggaccccccca
gatagcagccttgtcacttatgaactacattctcggcctgagcaggacaagttctctcaa
gctgccaaagtcgcagaacttgaaaagcgcctgacagagctggagacagctgtacgttgt
gatcaggatgctcagaatcccctttctgcaggtctacagggagcctgtctcatggagact
gtagagctgttgcaagcaaaggtgagcgccctagaccttgcagttttggatcaagtggag
gctcggctacagagtgtcctgggaaaggtgaacgagattgccaagcataaagcctctgta
gaagatgcagatacacaaagcaaggtgcaccagctatatgaaactatacagcgctggagc
cccattgcctccaccctccctgagctggtgcagagacttgtcaccatcaagcagctgcac
gagcaagccatgcagtttggtcagctcctgacacacttggataccacccagcagatgatt
gctaattccttgaaggacaataccaccctcttgacccaggtgcagacaaccatgcgtgaa
aacctggccacagttgaggggaactttgccagcattgatgaacggatgaagaagctggga
aagtga

KEGG   Homo sapiens (human): 10671
Entry
10671             CDS       T01001                                 

Gene name
DCTN6, WS-3, WS3, p27
Definition
(RefSeq) dynactin subunit 6
  KO
K10428  dynactin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    10671 (DCTN6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10671 (DCTN6)
   05016 Huntington disease
    10671 (DCTN6)
   05022 Pathways of neurodegeneration - multiple diseases
    10671 (DCTN6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10671 (DCTN6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10671 (DCTN6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10671 (DCTN6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     10671 (DCTN6)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     10671 (DCTN6)
SSDB
Motif
Pfam: Hexapep
Other DBs
NCBI-GeneID: 10671
NCBI-ProteinID: NP_006562
OMIM: 612963
HGNC: 16964
Ensembl: ENSG00000104671
Vega: OTTHUMG00000163828
Pharos: O00399(Tdark)
UniProt: O00399
LinkDB
Structure
PDB: 
3TV0

Position
8p12
AA seq 190 aa
MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA
LIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILT
SGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
MKGSSTPVKN
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcggagaagactcaaaagagtgtgaagattgctcctggagcagttgtatgtgtagaa
agtgaaatcagaggagatgtaactatcggacctcggacagtgatccaccctaaagcaaga
attattgcggaagccgggccaatagtgattggcgaagggaacctaatagaagaacaggcc
cttatcataaatgcttacccagataatatcactcctgacactgaagatccagaaccaaaa
cctatgatcattggcaccaataatgtgtttgaagttggctgttattcccaagccatgaag
atgggagataataatgtcattgaatcaaaagcatatgtaggcagaaatgtaatattgaca
agtggctgcatcattggggcttgttgcaacctaaatacatttgaagtcatccctgagaat
acggtgatctatggtgcagactgccttcgtcgggtgcagactgagcgaccgcagccccag
acactacagctggatttcttgatgaaaatcttgccaaattaccaccacctaaagaagact
atgaaaggaagctcaactccagtaaagaactaa

KEGG   Homo sapiens (human): 1639
Entry
1639              CDS       T01001                                 

Gene name
DCTN1, DAP-150, DP-150, P135
Definition
(RefSeq) dynactin subunit 1
  KO
K04648  dynactin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01158  Mutation-caused aberrant DCTN1 to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00856  Distal hereditary motor neuropathies
H00879  Perry syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    1639 (DCTN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    1639 (DCTN1)
   05016 Huntington disease
    1639 (DCTN1)
   05022 Pathways of neurodegeneration - multiple diseases
    1639 (DCTN1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    1639 (DCTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1639 (DCTN1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    1639 (DCTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1639 (DCTN1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    1639 (DCTN1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     1639 (DCTN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     1639 (DCTN1)
SSDB
Motif
Pfam: Dynactin CAP_GLY Filament
Other DBs
NCBI-GeneID: 1639
NCBI-ProteinID: NP_004073
OMIM: 601143
HGNC: 2711
Ensembl: ENSG00000204843
Vega: OTTHUMG00000129963
Pharos: Q14203(Tbio)
UniProt: Q14203 Q6MZZ3
LinkDB
Structure
PDB: 

Position
2p13.1
AA seq 1278 aa
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRE
GTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSS
SEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAE
DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADT
ADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQL
KQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAE
STIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARE
TELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEA
SVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPG
GDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSL
SLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL
TKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDI
ALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAV
LQEVAAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTM
NKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLK
IKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQ
ADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGAIPGQAPGS
VPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPG
SELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVE
KLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRH
RLVLTQEQLHQLHSRLIS
NT seq 3837 nt   +upstreamnt  +downstreamnt
atggcacagagcaagaggcacgtgtacagccggacgcccagcggcagcaggatgagtgcg
gaggcaagcgcccggcctctgcgggtgggctcccgtgtagaggtgattggaaaaggccac
cgaggcactgtggcctatgttggagccacactgtttgccactggcaaatgggtaggcgtg
attctggatgaagcaaagggcaaaaatgatggaactgttcaaggcaggaagtacttcact
tgtgatgaagggcatggcatctttgtgcgccagtcccagatccaggtatttgaagatgga
gcagatactacttccccagagacacctgattcttctgcttcaaaagtcctcaaaagagag
ggaactgatacaactgcaaagactagcaaactgcggggactgaagcctaagaaggcaccg
acagcccgaaagaccacaactcggcgacccaagcccacgcgcccagccagtactggggtg
gctggggccagtagctccctgggcccctctggctcagcgtcagcaggtgagctgagcagc
agtgagcccagcaccccggctcagactccgctggcagcacccatcatccccacgccggtc
ctcacctctcctggagcagtccccccgcttccttccccatccaaggaggaggagggacta
agggctcaggtgcgggacctggaggagaaactagagaccctgagactgaaacgggcagaa
gacaaagcaaagctaaaagagctggagaaacacaaaatccagctggagcaggtgcaggaa
tggaagagcaaaatgcaggagcagcaggccgacctgcagcggcgcctcaaggaggcgaga
aaggaagccaaggaggcgctggaggcaaaggaacgctatatggaggagatggctgatact
gctgatgccattgagatggccactttggacaaggagatggctgaagagcgggctgagtcc
ctgcagcaggaggtggaggcactgaaggagcgggtggacgagctcactactgacttagag
atcctcaaggctgagattgaagagaagggctcagatggcgctgcatccagttatcagctc
aagcagcttgaggagcagaatgcccgcctgaaggatgccctggtgaggatgcgggatctt
tcttcctcagagaagcaggagcatgtgaagctccagaagctcatggaaaagaagaaccaa
gagctggaagttgtgaggcaacagcgggagcgtctgcaggaggagctaagccaggcagag
agcaccattgatgagctcaaggagcaggtggatgctgctctgggtgctgaggagatggtg
gagatgctgacagatcggaacctgaatctggaagagaaagtgcgcgagttgagggagact
gtgggagacttggaagcgatgaatgagatgaacgatgagctgcaggagaatgcacgtgag
acagaactggagctgcgggagcagctggacatggcaggcgcgcgggttcgtgaggcccag
aagcgtgtggaggcagcccaggagacggttgcagactaccagcagaccatcaagaagtac
cgccagctgaccgcccatctacaggatgtgaatcgggaactgacaaaccagcaggaagca
tctgtggagaggcaacagcagccacctccagagacctttgacttcaaaatcaagtttgct
gagactaaggcccatgccaaggcaattgagatggaattgaggcagatggaggtggcccag
gccaatcgacacatgtccctgctgacagccttcatgcctgacagcttccttcggccaggt
ggggaccatgactgcgttctggtgctgttgctcatgcctcgtctcatttgcaaggcagag
ctgatccggaagcaggcccaggagaagtttgaactaagtgagaactgttcagagcggcct
gggctgcgaggagctgctggggagcaactcagctttgctgctggactggtgtactcgctg
agcctgctgcaggccacgctacaccgctatgagcatgccctctctcagtgcagtgtggat
gtgtataagaaagtgggcagcctgtaccctgagatgagtgcccatgagcgctccttggat
ttcctcattgaactgctgcacaaggatcagctggatgagactgtcaatgtggagcctctc
accaaggccatcaagtactatcagcatctgtacagcatccaccttgccgaacagcctgag
gactgtactatgcagctggctgaccacattaagttcacgcagagtgctctggactgcatg
agtgtggaggtaggacggctgcgtgccttcttgcagggtgggcaggaggctacagatatt
gccctcctgctccgggatctggaaacttcatgcagtgacatccgccagttctgcaagaag
atccgaaggcgaatgccagggacagatgctcctgggatcccagctgcactggcctttgga
ccacaggtatctgacacgctcctagactgcaggaaacacttgacgtgggtcgtggctgtg
ctgcaggaggtggcagctgctgctgcccagctcattgccccactggcagagaatgagggg
ctacttgtggctgctctggaggaactggctttcaaagcaagcgagcagatctatgggacc
ccctccagcagcccctatgagtgtctgcgccagtcatgcaacatcctcatcagtaccatg
aacaagctggccacagccatgcaggagggggagtatgatgcagagcggccccccagcaag
cctccaccggttgaactgcgggctgctgcccttcgtgcagagatcacagatgctgaaggc
ctgggtttgaagctcgaagatcgagagacagttattaaggagttgaagaagtcactcaag
attaagggagaggagctaagtgaggccaatgtgcggctgagcctcctggagaagaagttg
gacagtgctgccaaggatgcagatgagcgcatcgagaaagtccagactcggctggaggag
acccaggcactgctgcgaaagaaggagaaagagtttgaggagacaatggatgcactccag
gctgacatcgaccagctggaggcagagaaggcagaactaaagcagcgtctgaacagccag
tccaaacgcacgattgagggactccggggccctcctccttcaggcattgctactctggtc
tctggcattgctggtgaagaacagcagcgaggagccatccctgggcaggctccagggtct
gtgccaggcccagggctggtgaaggactcaccactgctgcttcagcagatctctgccatg
aggctgcacatctcccagctccagcatgagaacagcatcctcaagggagcccagatgaag
gcatccttggcatccctgccccctctgcatgttgcaaagctatcccatgagggccctggc
agtgagttaccagctggagcgctgtatcgtaagaccagccagctgctggagacattgaat
caattgagcacacacacgcacgtagtagacatcactcgcaccagccctgctgccaagagc
ccgtcggcccaacttatggagcaagtggctcagcttaagtccctgagtgacaccgtcgag
aagctcaaggatgaggtcctcaaggagacagtatctcagcgccctggagccacagtaccc
actgactttgccaccttcccttcatcagccttcctcagggccaaggaggagcagcaggat
gacacagtctacatgggcaaagtgaccttctcatgtgcggctggttttggacagcgacac
cggctggtgctgacccaggagcagctgcaccagcttcacagtcgcctcatctcctaa

KEGG   Homo sapiens (human): 51164
Entry
51164             CDS       T01001                                 

Gene name
DCTN4, DYN4, P62
Definition
(RefSeq) dynactin subunit 4
  KO
K10426  dynactin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    51164 (DCTN4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    51164 (DCTN4)
   05016 Huntington disease
    51164 (DCTN4)
   05022 Pathways of neurodegeneration - multiple diseases
    51164 (DCTN4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    51164 (DCTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    51164 (DCTN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    51164 (DCTN4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     51164 (DCTN4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     51164 (DCTN4)
SSDB
Motif
Pfam: Dynactin_p62
Other DBs
NCBI-GeneID: 51164
NCBI-ProteinID: NP_057305
OMIM: 614758
HGNC: 15518
Ensembl: ENSG00000132912
Vega: OTTHUMG00000130079
Pharos: Q9UJW0(Tbio)
UniProt: Q9UJW0 A0A0S2Z5D4 Q9NSJ5
LinkDB
Position
5q33.1
AA seq 460 aa
MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSD
KYGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLT
EVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQL
VAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPDDINSTAKVVV
PPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFK
MKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggcgtccttgctgcagtcggaccgggttctctatctagtccagggagaaaagaaggtt
cgggccccgctctcgcaactctacttctgccgctattgtagcgaactgcggtcgctggaa
tgtgtgtctcacgaggtggactcccattattgtcccagttgtttagaaaatatgccatcg
gctgaagccaaactaaaaaagaatagatgtgccaattgttttgactgtcctggctgcatg
cacaccctctctactcgggccacgagcatctccacacagcttccagatgacccagccaag
accaccatgaagaaagcctattacctggcatgtggattttgtcgctggacgtctagagat
gtgggcatggcagacaaatctgtagctagtggcggttggcaggaacctgaaaatcctcac
acacaacggatgaacaaattgattgaatattaccagcagcttgctcagaaagagaaggtt
gagcgagatcgcaagaaactggcacgacgtagaaactatatgcctctggctttttcggac
aaatatggtcttggaaccaggcttcagcgaccacgagctggtgcatccatcagtaccctt
gccggactttcccttaaagaaggagaggatcagaaagagataaagattgagccagctcag
gctgtggatgaagtggaacctctacctgaagactattatacaagaccagtaaatttaaca
gaggtaacaacccttcagcagcgtctgttacagcctgacttccagccagtctgtgcttca
cagctctatcctcgccacaaacatcttctgatcaaacggtccctgcgctgccgtaaatgt
gaacataatttgagcaagccagaatttaacccaacgtcaatcaaattcaaaatccagctg
gtcgctgtcaattatattccagaagtgagaatcatgtcaattcccaaccttcgctacatg
aaggagagccaggtcctcctgactcttacaaatccagttgagaacctcacccatgtgact
ctcttcgagtgtgaggagggggaccctgatgatatcaacagcactgctaaggtggtggtg
cctcccaaagagctcgttttagctggcaaggatgcagcagcagagtacgatgagttggca
gaacctcaagactttcaggacgatcctgacattatagccttcagaaaggccaacaaagtg
ggtattttcatcaaagttacaccacagcgtgaggagggtgaagtgaccgtgtgcttcaag
atgaagcatgattttaaaaacctggcagcccccattcgccccattgaagaaagtgaccag
ggaacagaagtcatctggctcacccagcatgtggaacttagcttgggcccacttcttcct
taa

KEGG   Homo sapiens (human): 84516
Entry
84516             CDS       T01001                                 

Gene name
DCTN5
Definition
(RefSeq) dynactin subunit 5
  KO
K10427  dynactin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    84516 (DCTN5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    84516 (DCTN5)
   05016 Huntington disease
    84516 (DCTN5)
   05022 Pathways of neurodegeneration - multiple diseases
    84516 (DCTN5)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    84516 (DCTN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84516 (DCTN5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    84516 (DCTN5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     84516 (DCTN5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     84516 (DCTN5)
SSDB
Motif
Pfam: Hexapep Hexapep_2 DUF4954 Fucokinase
Other DBs
NCBI-GeneID: 84516
NCBI-ProteinID: NP_115875
OMIM: 612962
HGNC: 24594
Ensembl: ENSG00000166847
Vega: OTTHUMG00000131610
Pharos: Q9BTE1(Tdark)
UniProt: Q9BTE1
LinkDB
Position
16p12.2
AA seq 182 aa
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagttgggcgagctgctctacaacaagtctgagtacatcgagacggcatctgggaac
aaagtcagtcgccagtcagtgttgtgtggaagccagaacatcgttctcaatggcaagacc
attgtgatgaatgactgtattatccgaggggatctggcaaatgtaagagttggacgtcat
tgtgttgtgaaaagtcgtagtgtcataaggccaccattcaagaagttcagcaaaggtgtt
gcattctttcctttacatattggagaccatgtctttattgaggaagattgtgtggtcaac
gcagcacagattggttcctatgttcatgttgggaagaactgtgtgattgggcgccgatgt
gtgttgaaagactgctgcaaaattcttgacaacacagtattacctccagaaactgtggtt
ccaccattcactgtcttctcaggctgcccaggactcttctcaggggagctcccggagtgc
actcaggagctgatgattgacgtcaccaagagctactaccagaagtttttgcccctgacg
caagtctag

DBGET integrated database retrieval system