KEGG   Homo sapiens (human): 10564Help
Entry
10564             CDS       T01001                                 

Gene name
ARFGEF2, BIG2, PVNH2, dJ1164I10.1
Definition
(RefSeq) ADP ribosylation factor guanine nucleotide exchange factor 2
  KO
K18442  brefeldin A-inhibited guanine nucleotide-exchange protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H00270  Periventricular nodular heterotopia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10564 (ARFGEF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10564 (ARFGEF2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    10564 (ARFGEF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 Sec7_N DCB DUF1981
Motif
Other DBs
NCBI-GeneID: 10564
NCBI-ProteinID: NP_006411
OMIM: 605371
HGNC: 15853
Ensembl: ENSG00000124198
Vega: OTTHUMG00000032687
Pharos: Q9Y6D5(Tbio)
UniProt: Q9Y6D5 Q86TH5 Q59FR3
LinkDB All DBs
Structure
PDB: 

Position
20q13.13
AA seq 1785 aa AA seqDB search
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGTAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICSCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPIQSKPQSPVIQAAAVSPKFVRLKHSQAQS
KPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSA
IKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGH
QVAARFSHVLQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLSVLQNAGP
VFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQIEVFFKE
IFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKI
AQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGQERLTDQE
IGDGKGLDMARRCSVTSMESTVSSGTQTTVQDDPEQFEVIKQQKEIIEHGIELFNKKPKR
GIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSARFNKEVMYAYVDQLDFCEK
EFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIMLT
TDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETKELTIATK
STKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTP
LLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSSI
TEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSGSGRE
REGSLKGHTLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVVAVDRIFTGST
RLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWHVIGD
HFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIR
DMAIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTCHIVTTIFQHHF
PAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTSDDMNVAP
GDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRIVFR
IFDNMKLPEQLSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQLQWCVKQDN
EQLARSGTNCLENLVISNGEKFSPEVWDETCNCMLDIFKTTIPHVLLTWRPVGMEEDSSE
KHLDVDLDRQSLSSIDKNPSERGQSQLSNPTDDSWKGRPYANQKLFASLLIKCVVQLELI
QTIDNIVFYPATSKKEDAEHMVAAQQDTLDADIHIETEDQGMYKYMSSQHLFKLLDCLQE
SHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDENRRDSWE
EIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASMYYPYLC
EIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPSQVPAALSPVW
NT seq 5358 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagagccagaccaagagcatgttcgtgtcccgggccctggagaagatcctagcc
gacaaggaggtgaagcggccccagcactcccagctgcgcagggcctgccaggtggcgctc
gatgaaattaaagcagaaatagaaaagcagaggcttggcactgctgcaccaccaaaggca
aacttcattgaagctgacaagtattttcttccattcgagctagcttgccagtccaagtcc
ccaagggtagtcagcacatcccttgactgcttgcagaaactcatcgcatacgggcacatc
actggcaacgcccctgacagtggagcccctgggaagcggctgatcgacagaattgttgaa
accatttgcagttgttttcagggccctcagactgatgaaggggttcagttacaaataatt
aaggctcttctgactgcagtgacttccccacacattgaaattcatgagggtactatcctg
cagacagtgagaacatgttacaatatctatttggccagcaaaaatctcatcaatcaaacc
actgccaaggctacccttactcagatgctgaacgtcattttcacccgcatggaaaaccaa
gtgttgcaggaggccagagaactggaaaaaccaatccagtcaaaaccccagtcccctgtg
atccaagctgcagcagtatccccaaagttcgttcgtttgaagcacagtcaggcacaaagc
aaaccaacaactcccgaaaaaacagatttaaccaacggtgaacatgccaggagtgattct
ggaaaagtaagcacagaaaatggagacgcacccagagaaagaggctcatcactgtcaggg
actgatgacggagcccaggaggtggtgaaggacatcttggaagatgtagtcacatctgcc
attaaagaagcagcggaaaagcatggtctgacagaacctgagagagttctaggtgaactg
gagtgccaggaatgtgctattcccccaggagttgatgaaaactcacagaccaacgggata
gccgatgacaggcagtccttgtcgtcagcagataatctggaatcggatgcacaaggacat
caagtggctgccaggttctcccacgttctgcagaaggatgccttccttgtgttccgctcc
ctgtgcaagctgtccatgaaaccccttggtgaaggccctccagacccaaaatcccatgag
ctgcgttccaaggtggtttccctgcagctgctcctctctgtgttgcaaaatgctggcccc
gtattcaggactcacgagatgttcatcaatgcaatcaagcaatatctctgtgtggccttg
tccaaaaacggcgtctcttcagtgcctgatgtctttgagctctctcttgccatttttctt
actcttctttcaaactttaaaatgcacttgaaaatgcagatagaggtctttttcaaagag
attttcctgaacattttagaaacatcaacaagttcttttgagcacaggtggatggtcatt
cagactctgacgaggatctgtgcagatgcccagtgtgttgtggatatttatgtcaactac
gactgtgatttaaatgctgctaacatttttgagcgccttgtaaatgatttatccaaaatt
gctcagggaagaagtggacatgagctgggaatgacacctctgcaggagctcagcctgagg
aagaaaggcctggagtgcctcgtgtccattctcaagtgcatggtggagtggagcaaagac
ctgtatgtgaatcccaaccaccagaccagcctcggtcaggagaggctcacggatcaggaa
ataggggatgggaaaggccttgacatggcaagacggtgtagtgtgacgtccatggagtcc
acagtgtcctcggggacccagacaactgttcaggatgaccctgagcaatttgaggtcatc
aagcaacaaaaagaaatcattgaacacggcatcgagctgttcaacaagaaacccaagagg
gggatccagtttctccaggagcagggcatgctgggaacgtcagttgaagacatagcccaa
ttcctgcaccaggaggagcgcctggattccacccaagtaggcgattttctgggagatagc
gcaaggttcaacaaggaggtgatgtatgcctacgtggaccaacttgacttctgtgaaaaa
gaatttgtctcagccctgcggacattcctagaaggtttccgcctacctggagaagcccaa
aagattgaccgattaatggagaagtttgccgcaagatacatagaatgcaaccaagggcaa
actctgtttgctagtgctgacactgcttatgtcctagcgtattcaattattatgctgact
acagacttgcacagtcctcaggtaaaaaataaaatgacgaaagagcagtatattaaaatg
aatcggggtatcaatgatagtaaagatctgccagaagagtatctctcaagcatctatgaa
gagatagaaggcaagaaaattgcaatgaaagaaacaaaagagctaacgattgcaaccaaa
tctactaagcagaatgtagctagtgaaaagcagcggcggctgctgtacaacttagagatg
gagcaaatggctaaaacagccaaagctctgatggaggctgtgagccatgccaaagccccg
tttaccagtgccactcacctggaccatgtccggccaatgttcaaactggtgtggacgcca
ctattggcagcctacagcatcggactccagaactgtgatgacactgaagtggcctccttg
tgtttggaaggcatccgatgtgcaatccgaatcgcctgcatctttggaatgcagctggaa
cgagatgcctatgttcaggctcttgctcgcttctccctactcacagccagctccagcatc
acagaaatgaagcagaaaaacatcgacaccattaagacgcttatcacagtggctcacacc
gatggcaactaccttgggaattcctggcatgagatcttgaaatgcatcagccagctggag
ctcgctcagctgataggaaccggtgtgaagacgcgctacctgtctggatctgggcgtgaa
agagaagggagcctgaagggccacacattggcaggagaagagttcatgggccttggcctc
ggtaatttggtgagtggcggagtggataaaagacagatggccagcttccaagaatcggtt
ggtgagaccagctcgcagagtgtggttgtagctgtggacaggatttttactgggtctacc
agactggatggaaatgcaatagttgactttgtccgctggctgtgtgctgtgtccatggat
gaactggcttccccccaccatcctcgcatgttcagcttgcagaagattgtggagatatca
tactacaacatgaatcggatccgactacagtggtctcgaatatggcatgtgattggagat
cacttcaataaggttggctgcaaccctaatgaagatgtggctatctttgctgttgactca
ttaaggcaactctccatgaagtttcttgagaagggtgaattagccaacttccgtttccag
aaagattttctgaggccctttgagcatattatgaagaaaaacaggtctcccaccatccgg
gacatggcgatccgctgcattgcccagatggtgaactcccaggcggccaacatccgctca
ggttggaagaacatctttgccgtgttccaccaggcagcctctgatcatgatgggaacatt
gtggagctggccttccagaccacttgccacattgtcacaactattttccagcaccatttt
cctgcagccatcgattcctttcaggatgctgtgaagtgcttatcagagttcgcctgcaac
gccgctttccctgacacgagcatggaagcgattcggctcatccgcttctgtggcaaatac
gtctctgagaggcctcgggtgctacaagaatacacaagtgatgacatgaatgtagctcct
ggtgacagagtctgggtccgaggctggttccccatcttattcgaactctcctgcatcatt
aatagatgcaagttagatgtacgaacaaggggactcacagtcatgtttgagatcatgaag
agctatggccacacctttgaaaagcactggtggcaggacctgttcagaatcgtgtttcgg
atttttgacaatatgaaactccctgagcaactgtcagagaaatctgagtggatgacaaca
acctgcaatcacgcactttatgctatttgtgatgtttttacccagttttatgaagctttg
aatgaagttcttctttctgatgtatttgcacaattgcagtggtgtgtcaaacaagataat
gaacagttggcgcgatcaggtacaaattgcttagaaaacttagtaatatccaatggagag
aaattcagtcctgaagtctgggatgaaacctgcaactgtatgttggatattttcaaaaca
accatcccacatgttttgctgacatggagacctgtaggaatggaggaagattcatcagaa
aagcatttggatgtggatctggaccgccagtctttaagcagcatagataaaaatccctct
gagaggggacagagccagctctctaacccaacagatgacagctggaagggtagaccatac
gcaaatcagaaactgtttgccagcctcctcatcaagtgtgtggtccagttggaattgata
cagaccattgacaacattgtgttctaccctgcgacgagcaaaaaggaggatgcagagcac
atggttgccgcccagcaagacacgctggatgcagatatccacatagagacggaggatcag
ggcatgtataagtacatgtcttcccagcacctcttcaagctgttggactgtttgcaggaa
tcccattcattctcaaaggccttcaactccaattacgagcagcggactgtcctgtggcga
gcaggttttaagggcaagtctaaacccaatcttctaaaacaagaaaccagcagcctggcc
tgttgtttgaggatcctgtttcgaatgtatgttgatgagaaccgcagggattcctgggaa
gaaatacagcagagacttttaactgtttgcagtgaagctcttgcctatttcatcactgtg
aattctgagagccatcgggaggcctggacaagtctcttgttgttacttctaactaaaacc
ctcaaaataaatgatgaaaagttcaaagcacatgcttcaatgtactacccctacttgtgt
gaaattatgcagtttgacctgatccctgagctccgagcagttctgcggaagttcttccta
cggataggtgttgtgtataagatatggataccagaagagccatcacaggtaccagcagca
ctgtcaccagtgtggtag

KEGG   Homo sapiens (human): 10565Help
Entry
10565             CDS       T01001                                 

Gene name
ARFGEF1, ARFGEP1, BIG1, P200
Definition
(RefSeq) ADP ribosylation factor guanine nucleotide exchange factor 1
  KO
K18442  brefeldin A-inhibited guanine nucleotide-exchange protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10565 (ARFGEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10565 (ARFGEF1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    10565 (ARFGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 Sec7_N DCB DUF1981
Motif
Other DBs
NCBI-GeneID: 10565
NCBI-ProteinID: NP_006412
OMIM: 604141
HGNC: 15772
Ensembl: ENSG00000066777
Vega: OTTHUMG00000164626
Pharos: Q9Y6D6(Tbio)
UniProt: Q9Y6D6 A0A024R7X0
LinkDB All DBs
Structure
PDB: 

Position
8q13.2
AA seq 1849 aa AA seqDB search
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKAETEKQSPPHGEAKA
GSSTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGNAPDST
TPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQMEKERHRQHHHLLQSPVSHHE
PESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEADQ
ATAAETLSKNEVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGT
IEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKFSHILQ
KDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPIFRTNEMFINA
IKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTS
SFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGM
SNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPSEQEMSEIKHPETIN
RYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYL
QEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSA
LRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHS
PQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPTKSSKQN
VASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAF
SVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQ
KNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSL
TGTKDQAPDEFVGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAI
VDFVRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGC
NPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCI
AQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTLVFEKHFPATIDSF
QDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEYTSDDMNVAPEDRVWVR
GWFPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKL
PEQQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSG
TNCLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHALLTWRPNSGETAPPPPSPVSEK
PLDTISQKSVDIHDSIQPRSVDNRPQAPLVSASAVNEEVSKIKSTAKFPEQKLFAALLIK
CVVQLELIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFDVRVDTQDQGMYRFLTSQQLF
KLLDCLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYMD
ESRVSAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDNRFKAHA
SFYYPLLCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPPEQELGINKQ
NT seq 5550 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaggggaagaagacgaagaacatgttcctgacccgggctctggagaagatattg
gccgacaaggaagtgaagaaggcgcatcactcccagctgcgcaaagcttgcgaggtggcg
ttagaggaaataaaagcggaaactgaaaaacagagtcctcctcatggagaagcaaaagct
ggatcaagcacccttccaccagtgaaatcaaagacaaattttattgaagcagacaagtac
ttcttgccttttgagttggcatgccagtccaaatgtcctcgcatagttagtacatctcta
gattgcttacagaaacttattgcttatgggcacttgactggcaatgctccagatagtaca
acaccaggcaaaaaattaattgatagaattattgaaacaatatgtggctgctttcagggc
cctcagacagatgaaggagttcagctgcagataataaaggctttacttactgcagtaaca
tcacaacacatagaaattcatgaagggactgtactgcaagctgtgagaacatgttacaat
atctacttagcaagcaaaaatctcatcaatcagacaacagccaaagctactctcactcag
atgctaaatgttatctttgcacgcatggaaaaccaagcattacaggaagcaaaacaaatg
gaaaaagaaaggcatcggcagcatcatcatctgttacagtctccagtaagccatcacgag
cctgaatcacctcaacttagatatttgccacctcagactgttgatcatatatcccaagaa
cacgaaggggaccttgacctccatacaaatgatgtagataaaagtcttcaggatgacaca
gagcctgaaaatggatctgatatttccagtgcagaaaatgaacagactgaagctgatcag
gcaactgcagctgaaacattatctaaaaatgaagtgttatatgacggagaaaaccatgat
tgtgaggaaaagccacaagacattgtacagaacattgtagaagaaatggtgaacattgtt
gttggagatatgggagaagggactactataaatgcaagtgcagatggcaacattggaact
atagaggatggtagtgacagtgaaaatattcaagcaaatggaattccaggaacaccaatt
tctgttgcatatacaccatccttacctgatgatagattgtcagtctcttccaatgatact
caggaatctggaaattcttcaggaccttcacctggtgctaagttttcccacattttacaa
aaggatgcctttctagtattcaggtcattgtgtaaactgtcaatgaaaccactgtcagat
ggaccaccagatccaaagtctcatgaactacgatccaagattctttcattgcagttactt
ctatccattctgcagaatgcaggacctattttcaggacaaatgagatgtttattaatgct
attaagcagtatctttgtgttgcactctcaaaaaatggagtctcatctgttccagaggtt
tttgagctttctctttctatatttcttactttgttgtcaaatttcaagacacatctgaag
atgcaaattgaggtgttctttaaagaaattttcttatacattttggaaacttctaccagc
tcatttgatcacaaatggatggttattcagacactgacgaggatttgtgcagatgctcag
agtgtagtggatatttatgtaaactatgactgtgacttaaatgcagccaatatatttgaa
agactagtaaatgatctatcaaaaattgctcaaggaaggggcagtcaagaacttggtatg
agtaatgttcaggaattgagcctgaggaaaaaaggtttagaatgcttagtgtcgattttg
aagtgtatggttgaatggagtaaggatcagtatgtgaatcccaactcccagacaactctt
ggtcaggaaaaaccctcagagcaagagatgagtgaaatcaaacaccctgagacaataaac
agatacggaagtttaaattccctggagtcaacatcatcatcaggaataggcagctacagt
acacagatgtctggcactgataatccagaacaatttgaggtcctaaagcaacaaaaagaa
ataatagaacaagggatagatttatttaataagaaaccaaagagaggaatacagtacctc
caagaacaagggatgcttggcaccacacctgaagatattgcccaattcttacatcaagag
gaaagattagactctactcaagtgggtgagttcctgggagataatgataaatttaacaaa
gaagtcatgtatgcatatgtggaccaacatgacttttcaggaaaagacttcgtttcagcc
cttcgtatgtttctagaaggatttcgtcttccaggggaagctcagaaaatcgatcgatta
atggaaaaatttgctgcaagatacctagaatgcaaccaaggacaaactctctttgctagt
gcggatacagcttatgttttggcttattcaattatcatgttgaccacagaccttcacagt
ccacaggtgaaaaataaaatgacaaaggaacaatacattaagatgaatagaggtatcaat
gacagtaaagaccttcctgaagagtatctatcagccatctataatgaaatagctgggaaa
aagatatcaatgaaagaaacaaaagaactaacaatccctacaaaatcaagtaaacagaat
gtagccagtgaaaaacaaagaagacttctgtataacttagaaatggagcagatggccaag
acagctaaagcactcatggaggccgtgagccatgttcaggcaccctttacaagtgcaaca
catttggagcatgtgaggcccatgtttaagttggcttggacgccttttctggctgcattc
agtgtgggtctacaagattgtgatgatactgaagtagcctctctttgcctggaaggtata
agatgtgcaatcagaattgcatgcattttcagcattcagctggagagagatgcatatgtc
caggcactagcaagatttaccttactcacagtgagttccggtattactgaaatgaaacag
aagaacattgacacaataaaaacacttatcacagtggctcatacagatggaaattattta
ggaaattcatggcatgagattctgaagtgcatcagtcagttggagctggcacagcttata
ggaactggagtgaaacctcgatacatttctggaacagtgcgaggcagagaaggatctctt
actggaacaaaagatcaggctcctgatgaatttgtgggtttagggctagttggaggaaat
gtggactggaaacagatagcaagtattcaggaatccattggagaaaccagttctcagagt
gttgttgttgctgtagatagaatattcacaggatctacaaggctagatggaaatgccatt
gtggattttgtccgttggctctgtgctgtgtctatggatgaattactttccacgacacac
ccaagaatgtttagtctacaaaaaatagtagaaatatcatattacaacatgggaagaata
agattacagtggtctcgaatttgggaagttattggagatcattttaataaggttgggtgt
aatcctaatgaagatgtagctatttttgcagtagactccttgaggcagttgtcaatgaag
ttcttagagaaaggggagcttgctaacttcagattccagaaggatttcttaagacctttt
gaacatataatgaaacggaacaggtctccaacaattcgagatatggttgtacggtgtata
gcacagatggttaattctcaagctgctaacattcgatctggatggaagaacattttctct
gtatttcatctagctgcatctgatcaagatgaaagcatagtggaacttgcattccaaaca
accgggcacattgtcacccttgtatttgaaaaacactttccagcgaccattgattctttc
caggatgcagtgaagtgtttgtctgaatttgcgtgcaatgcagctttcccagacacaagt
atggaagcaattcgacttattcgccattgtgcaaaatatgtgtctgatagacctcaggct
ttcaaggaatacacaagcgatgatatgaacgtagcacctgaagacagggtgtgggtgaga
ggatggttcccaattctctttgagttatcctgtatcatcaatagatgcaaattagatgta
agaaccaggggtttaacagtaatgtttgaaataatgaaaacatatggccacacttatgag
aaacactggtggcaggatttatttagaattgttttcagaatctttgacaatatgaaattg
ccagaacaacagacagagaaagctgaatggatgacaacaacttgcaatcatgcactttat
gcaatctgtgatgtattcactcagtatttagaagtactcagtgatgtacttttggatgac
atttttgctcagctctactggtgtgtgcagcaagacaatgagcagttagcgcgatctggt
acaaactgtttagagaatgttgttattctgaatggtgaaaaatttaccctagaaatctgg
gataaaacttgcaactgcacactggatatcttcaaaaccacaatcccacatgcgctgttg
acctggcgacccaattctggagaaactgcccccccacctccatctcctgtaagtgaaaag
ccattggatacaatatcacagaagtctgtagatattcatgattctattcaaccaaggtct
gtggataacagaccacaagcaccactggtttctgcgtctgctgttaatgaagaagtcagc
aaaattaaatctacagcaaaatttccagaacaaaaattgtttgctgccctgttgattaaa
tgtgttgtgcagctggaactcatccagactatcgacaacattgtcttcttcccagccaca
agtaagaaagaagatgcagaaaacttagctgcagcacagagagatgcggtggactttgat
gttcgcgttgatactcaagaccaaggaatgtaccgctttttaacatcacaacaacttttt
aagctactggactgcttattagagtcacatagatttgcaaaagcgtttaattccaacaac
gaacagaggactgccctgtggaaagcaggattcaaaggcaaatccaagcccaaccttctg
aagcaggagaccagcagcctggcctgtgggctgcgcattctcttccggatgtacatggat
gagagccgcgttagtgcctgggaggaggtccagcagaggcttttgaatgtctgcagtgaa
gcactaagttacttcctcactctaacatcagaaagtcatcgagaagcctggactaactta
ctgcttttgtttctaactaaagttctaaagataagtgataataggtttaaagctcatgca
tcattctactaccctctcttatgtgaaattatgcaatttgacttgattcctgaacttcgt
gctgttcttagaagattttttctgcgaatcggagtagtttttcagatatcacaaccacct
gaacaggaacttggaataaacaagcaatga

KEGG   Homo sapiens (human): 23096Help
Entry
23096             CDS       T01001                                 

Gene name
IQSEC2, BRAG1, IQ-ArfGEF, MRX1, MRX18, MRX78
Definition
(RefSeq) IQ motif and Sec7 domain 2
  KO
K12495  IQ motif and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23096 (IQSEC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23096 (IQSEC2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    23096 (IQSEC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IQ_SEC7_PH Sec7
Motif
Other DBs
NCBI-GeneID: 23096
NCBI-ProteinID: NP_001104595
OMIM: 300522
HGNC: 29059
Ensembl: ENSG00000124313
Vega: OTTHUMG00000021608
Pharos: Q5JU85(Tdark)
UniProt: Q5JU85
LinkDB All DBs
Structure
PDB: 

Position
Xp11.22
AA seq 1488 aa AA seqDB search
MEAGSGPPGGPGSESPNRAVEYLLELNNIIESQQQLLETQRRRIEELEGQLDQLTQENRD
LREESQLHRGELHRDPHGARDSPGRESQYQNLRETQFHHRELRESQFHQAARDVGYPNRE
GAYQNREAVYRDKERDASYPLQDTTGYTARERDVAQCHLHHENPALGRERGGREAGPAHP
GREKEAGYSAAVGVGPRPPRERGQLSRGASRSSSPGAGGGHSTSTSTSPATTLQRKSDGE
NSRTVSVEGDAPGSDLSTAVDSPGSQPPYRLSQLPPSSSHMGGPPAGVGLPWAQRARLQP
ASVALRKQEEEEIKRSKALSDSYELSTDLQDKKVEMLERKYGGSFLSRRAARTIQTAFRQ
YRMNKNFERLRSSASESRMSRRIILSNMRMQFSFEEYEKAQNPAYFEGKPASLDEGAMAG
ARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDSFSKQVKSLAESIDEALN
CHPSGPMSEEPGSAQLEKRESKEQQEDSSATSFSDLPLYLDDTVPQQSPERLPSTEPPPQ
GRPEFWAPAPLPPVPPPVPSGTREDGSREEGTRRGPGCLECRDFRLRAAHLPLLTIEPPS
DSSVDLSDRSDRGSVHRQLVYEADGCSPHGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPG
PLPPAPNSGTGPSGVAGGRRLGKCEAAGENSDGGDNESLESSSNSNETINCSSGSSSRDS
LREPPATGLCKQTYQRETRHSWDSPAFNNDVVQRRHYRIGLNLFNKKPEKGIQYLIERGF
LSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKF
QSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSV
KAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVG
KKPVLSLPHRRLVCCCQLYEVPDPNRPQRLGLHQREVFLFNDLLVVTKIFQKKKILVTYS
FRQSFPLVEMHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESI
AEVQEMEKYRVESELEKQKGMMRPNASQPGGAKDSVNGTMARSSLEDTYGAGDGLKRGAL
SSSLRDLSDAGKRGRRNSVGSLDSTIEGSVISSPRPHQRMPPPPPPPPPEEYKSQRPVSN
SSSFLGSLFGSKRGKGPFQMPPPPTGQASASSSSASSTHHHHHHHHHGHSHGGLGVLPDG
QSKLQALHAQYCQGPGPAPPPYLPPQQPSLPPPPQQPPPLPQLGSIPPPPASAPPVGPHR
HFHAHGPVPGPQHYTLGRPGRAPRRGAGGHPQFAPHGRHPLHQPTSPLPLYSPAPQHPPA
HKQGPKHFIFSHHPQMMPAAGAAGGPGSRPPGGSYSHPHHPQSPLSPHSPIPPHPSYPPL
PPPSPHTPHSPLPPTSPHGPLHASGPPGTANPPSANPKAKPSRISTVV
NT seq 4467 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggggtcggggcccccgggcggcccgggatccgagagcccaaatcgggccgtg
gagtacctgctggagctgaacaacatcatcgagagccagcagcagctgctggaaacccag
cggcggcgcatcgaggagctggagggccagctggaccagctcacccaggagaaccgcgac
ctgcgagaggagagccagctgcaccgcggggagctgcaccgggacccccacggcgcgcgg
gatagcccgggccgcgagagccagtaccagaacctgcgcgagacccagttccaccaccgc
gagctgcgggagagccagttccaccaggcggcccgggacgtgggctacccgaaccgggaa
ggcgcctaccagaatcgggaggctgtgtatcgggacaaggagcgggacgcctcctacccg
ctccaggacactaccggttacacagcccgcgagcgtgacgtggcccagtgccacctgcac
cacgagaacccagccctgggtcgcgagcgtggcgggcgggaggccgggccggcgcacccg
ggccgcgagaaggaagcgggctattcggcggcggtgggcgtggggccgcggccaccgcgg
gagcggggccagctgagccgtggcgcatccaggagctccagtcccggcgccggcggaggc
cacagcaccagtaccagcaccagcccggccacgaccctccagagaaaatctgatggtgag
aattccagaacagtcagtgtggagggtgatgccccaggcagtgacctgagcacagcggtt
gatagtcctgggagccaacccccctaccggctgagccagctgcccccctccagcagccac
atggggggcccccctgctggagtgggccttccctgggctcagcgggcacgcctccagcca
gccagtgtcgccctgaggaagcaggaggaggaggagataaagcgctccaaggccctatcg
gacagctatgaactctccacagacctgcaggacaagaaggtggaaatgctggagaggaag
tatgggggctccttcctgagccgcagggctgccaggaccatccagacagccttccgccag
taccgcatgaacaagaactttgagcggctacgcagctcagcctcagagagccgcatgtcc
cgccgcatcatcctttccaacatgcggatgcagttctcctttgaggagtatgagaaggca
cagaaccccgcgtacttcgagggcaagcctgcctcgctggacgagggtgccatggctggt
gcccggagccaccggcttgaacgggggctcccatatggaggctcctgtggtgggggcatc
gatggtggtggaagctccgtcaccacatctggagagttttctaatgacatcacagaactt
gaggactccttctccaaacaggtaaagtctctggctgaatccatcgacgaagccctgaac
tgccacccgtcagggcccatgtctgaggagccagggtcagcccagctggagaagcgggag
tcaaaggaacagcaagaggacagctcagccacatccttcagtgatcttcccctctacctg
gatgacacagttccccaacaatcccctgagcgactgcccagcacagaacccccaccccag
ggccggcccgagttctgggcgccagcccctctcccgccagttcctccaccagtgccatca
ggaacccgggaagacggtagccgtgaggaaggcactcgcaggggtcccgggtgcttggag
tgccgggatttccggctgcgggctgcccaccttcccctgcttaccattgagcctcctagt
gacagctccgtggacctgagtgaccgctcagatcgcggctctgtccaccgccagctggtg
tatgaggctgatggctgcagcccccatgggaccctgaagcacaaggggccaccaggcagg
gccccgatcccacaccgccactacccagcccctgaaggcccagccccagccccaccaggg
cccctgccaccagcccccaacagtggcactgggcccagtggtgtggctgggggtcggagg
ttggggaagtgcgaggcagcaggcgagaactctgatggtggagataacgagagccttgag
agctccagcaattccaatgagaccatcaactgcagctccggctcctcttctcgggacagt
ctaagggagcctccggctaccggcctgtgcaagcagacttaccagcgggagacaaggcat
agctgggactcgccagctttcaacaatgatgtggtccagaggcggcactaccgaatcggc
ctcaacctcttcaacaagaagccagagaagggtatccagtatctgatcgagcggggcttc
ctgtcagacacaccggtgggagtggctcacttcatcctggagcggaaaggcctcagccgg
cagatgataggggaattcctagggaaccggcagaagcagttcaacagagacgtgttggac
tgtgtggtggatgagatggacttctcctccatggatctggatgatgcgctccggaagttc
cagtcccatatccgggttcagggtgaggcccagaaagtggagcgactcatcgaagccttc
agccagcggtactgtgtctgtaacccagccctcgtgcgccagttccggaacccagacacc
atcttcatccttgcttttgccatcatcctcctcaataccgacatgtacagtcccagcgtc
aaagctgaacgaaagatgaaactagatgacttcatcaagaacctgagaggggttgacaat
ggtgaagacatcccccgagacctcctggtgggcatctaccagcgcatccaggggcgtgaa
ctgcggaccaacgatgaccatgtgtcccaggtgcaggctgtggagcgcatgattgttgga
aagaaaccagtcctgtctctccctcaccgtcgactggtttgctgctgccagctctacgag
gtgccagatccaaaccgcccccagaggctagggttgcatcagcgggaggtcttcctcttc
aatgatctccttgtggtcaccaaaattttccagaagaagaagatcttggtgacgtacagt
ttccgtcagtctttccccctcgtggaaatgcacatgcagctcttccagaattcatattac
cagtttgggatcaagttgctgtctgcagtacctggtggggagcgaaaagtcctcatcatc
ttcaatgcccccagcctccaggaccggctgcgctttacatccgacctgcgcgagtccatt
gcggaggtgcaggagatggagaaataccgtgtggagtcggagctggagaagcagaaaggt
atgatgcggcctaacgcctcacagcctggaggggccaaggactcagtgaatgggacgatg
gcccgcagtagcctggaggacacttacggggcaggcgatgggctcaaacggggcgcactc
agcagttccctgcgagacctctctgatgcagggaagcgggggcggcgtaacagcgtggga
tcgctggacagcaccatcgaagggtctgttattagcagtccacgccctcaccagaggatg
ccacctccgcccccacccccgccgccagaggagtacaagagccagaggcccgtctccaac
tcctcatccttcctgggctccctatttggaagcaagcggggcaaggggcccttccagatg
ccaccaccgccaacaggccaggcctctgcctcctcttcatctgcttcttccacgcaccac
caccaccaccaccaccatcatggccatagccacggtggcctgggggtgctgcctgatggg
cagtccaagctccaggccctgcatgcccagtattgccaaggaccgggccctgccccgcca
ccctacctcccaccccagcagccctctcttcccccacctccccagcagcccccacccttg
ccccagctgggctccattccaccgcctcccgcctcagccccacctgtggggccacatcgc
cacttccacgcccatggcccagtcccagggccccaacactataccttgggccggccaggc
agggcacccagacggggggctggaggacaccctcagtttgctccacatggccgccacccc
ctgcaccagcccacatccccactgcccctgtacagtcctgccccccagcaccctccagcc
cacaaacagggccctaagcacttcatcttcagccaccacccacagatgatgccagcagca
ggcgcggctgggggccctggatcccggccaccagggggctcctactcccacccccaccac
ccccagtcaccattgtcaccacactcacccatcccaccccacccctcctatccacccctc
cccccaccctcccctcacaccccgcactcaccccttccacccacctccccccatggcccg
ctgcacgcctctgggccccctggcacagccaacccccccagtgcaaaccccaaggccaag
ccaagccggatcagcaccgtggtctga

KEGG   Homo sapiens (human): 23362Help
Entry
23362             CDS       T01001                                 

Gene name
PSD3, EFA6D, EFA6R, HCA67
Definition
(RefSeq) pleckstrin and Sec7 domain containing 3
  KO
K12494  PH and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23362 (PSD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23362 (PSD3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    23362 (PSD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH_9 PH PH_11
Motif
Other DBs
NCBI-GeneID: 23362
NCBI-ProteinID: NP_056125
OMIM: 614440
HGNC: 19093
Ensembl: ENSG00000156011
Vega: OTTHUMG00000163711
Pharos: Q9NYI0(Tbio)
UniProt: Q9NYI0 B3KRC4
LinkDB All DBs
Position
8p22
AA seq 1047 aa AA seqDB search
MEGRSAAAETFVWVNNASAHSQSVAKAKYEFLFGRSEGKAPDTSDHGGSTLLPPNVTNEF
PEYGTMEEGGEGLRASLEFDGEALPCHPQEQQGVQPLTGCHSGLDSVTEGPKDVREAPSQ
SHLKEQSLQPIDSLISALKATEARIISGTLQATKVLDQDAVSSFSVQQVEKELDTASRKT
QRVNKTLPAGQKNLPEIPLSAEVTTEESFYLSIQKDLTALLTGDTQAEISQIMNNGRKGA
VCVQEPSCPLASLGSSAVTCHSAGSVGFLKEQRSALGREHPGGCDRSSSMGRPGRVKHVE
FQGVEILWTGGDKRETQHPIDFETSLQRTASPDSKESSKVPRHLISSAGLCNSSSLTENV
WDESWKAPSERPGTSSGTFSPVRLDESGEDEVFLQENKQHLEKTPKPERDRERISEQEEH
VKGEDEDILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYSEPDSYFSFEMPLTP
MIQQRIKEGGQFLERTSGGGHQDILSVSADGGIVMGYSSGVTNGLNDASDSIYTKGTPEI
AFWGSNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKR
SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERERVLIHFS
NRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHNIGKKMTCQEFIANLQGVNEGVDFSK
DLLKALYNSIKNEKLEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGSTTNPFLDIPHD
PNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEKALSEED
LKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFS
APPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKA
KDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSP
ITAKVKRNVSERKDHRPETPSIKQKVT
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaggagcgcagcggcagagacatttgtttgggtgaacaatgcatctgcacat
tcccagagtgttgccaaggccaaatatgaatttttatttggcagatctgaagggaaagct
ccagatactagtgatcatggaggaagcactttactcccaccaaatgtcacaaatgaattt
ccagaatatgggaccatggaggaaggtggagaaggcctaagggcttctctggaatttgat
ggtgaggctctgccatgccacccacaagagcagcagggtgtccagcctcttactggctgc
cactctgggctcgacagtgttacagaaggaccaaaagatgtcagagaggccccctctcaa
agtcatctcaaggaacaaagtttacagcccattgactctttgatttcagctctgaaagcc
acagaagccagaatcatttccggaacattacaggctacaaaggtactggaccaagatgct
gtttctagtttttcagttcagcaggtggaaaaagagctggacactgccagtcgtaaaaca
cagagagtcaacaaaacgctccctgctggccaaaaaaatttaccagaaatacctctttca
gctgaagtaacaacggaggaaagtttttatttgagcatccagaaagatctcaccgcgctg
ttaactggagacactcaggcagagatttcccagataatgaataatgggaggaaaggggct
gtctgtgtgcaggagccatcttgtcctttggcctccctcgggagctcagcagtgacctgc
cactctgcaggcagtgttggtttcttgaaagagcagaggtctgctcttgggagagagcac
ccagggggatgtgatcgaagcagctccatgggacgcccaggccgggtcaaacatgtggaa
tttcaaggagtggaaatactgtggacaggaggagacaagagagagacccagcatcctata
gattttgagacatcactgcaaagaacagcctctcctgacagcaaagagtcttccaaagtg
ccacgccatctcatctcatcagctggtttgtgtaattcaagtagtttaactgagaatgtt
tgggatgaatcctggaaagctccttcagagaggcctggcactagctcggggacattttcc
cctgtgcgtcttgatgagagtggagaggatgaagtcttcctacaggaaaacaaacagcat
cttgagaagacacctaaaccagagagagacagggaaaggatcagcgaacaagaggagcac
gttaagggggaagatgaagacatccttgggcctggatatacggaggactccaccgacgtg
tacagctcccagtttgaaaccattttggacaacacttctttatactacagtgcagagtcc
ctggagacattatactcagagcctgatagctattttagctttgaaatgcccctcactcca
atgatacaacagcgcattaaagaaggtggtcagttcttggagaggacatcagggggagga
catcaggatatcctgagtgtgtctgcagatggtggcatcgtgatgggctattctagtggc
gtcaccaatgggctgaatgatgccagcgactccatctacacgaaaggcaccccggagatt
gctttctggggaagcaatgctggggtgaaaacaacacggctagaagctcattctgaaatg
gggagcactgaaattttggaaaaggagaccccagaaaatctcagtaatggtaccagcagc
aatgtggaagcagccaaaaggttggccaaacgcctttatcagctggacagattcaaaaga
tcagatgttgcaaaacaccttggcaagaacaacgaatttagcaaactagttgcagaagaa
tatctgaagttttttgattttacaggaatgacgctggatcagtcactcaggtatttcttt
aaagcattctctcttgtgggagaaactcaagaacgagagagagttttaatacacttctcc
aatagatatttttattgtaacccagataccattgcttcacaagatggagtccattgcctt
acctgtgcaataatgcttcttaataccgatctacatggccacaatattggaaagaagatg
acctgtcaggagttcattgcaaatctgcaaggggtaaatgagggtgttgatttctccaag
gatctgctgaaagctctgtacaactcaatcaagaatgagaagcttgaatgggcagtagat
gatgaagagaaaaaaaagtctccctcagaaagtactgaggagaaagctaacggaacacat
ccaaagaccatcagtcgtattggaagtactactaacccatttttggacattcctcatgat
ccaaatgctgctgtgtacaaaagtggattcttggctcggaaaattcatgcagatatggat
ggaaagaagactccaagaggaaaacgaggatggaaaaccttttatgctgtactgaaggga
acagttctttacttgcaaaaggatgaatacaagccagaaaaggccttgtctgaagaggac
ttgaaaaacgctgtgagtgtgcaccacgcattggcatccaaggccacggactatgagaag
aaaccaaacgtgtttaaacttaaaactgccgactggagggtcttgctttttcaaactcag
agcccagaggaaatgcaagggtggataaacaaaatcaattgtgtggcagctgtattttct
gcaccaccatttccagcagcaatcggctctcagaagaagtttagccgcccacttctgcct
gccactacaacaaaactgtctcaggaggagcaactgaagtcacatgaaagtaagctgaag
cagatcaccaccgagctggccgagcaccgctcatatccccccgacaagaaggtcaaagcc
aaggacgtcgatgagtacaaactgaaagaccactatctggagtttgagaaaacccgctat
gaaatgtatgtcagcattctcaaggaaggaggcaaagagctactgagtaacgatgaaagc
gaggctgcaggactgaagaagtcgcactcgagtccttcgctgaacccggatacttctcca
atcactgccaaagtcaagcgtaacgtgtcagagaggaaggatcaccgacctgaaacacca
agcattaagcaaaaagttacttag

KEGG   Homo sapiens (human): 23550Help
Entry
23550             CDS       T01001                                 

Gene name
PSD4, EFA6B, TIC
Definition
(RefSeq) pleckstrin and Sec7 domain containing 4
  KO
K12494  PH and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23550 (PSD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23550 (PSD4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    23550 (PSD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH_9 PH Abi_2
Motif
Other DBs
NCBI-GeneID: 23550
NCBI-ProteinID: NP_036587
OMIM: 614442
HGNC: 19096
Ensembl: ENSG00000125637
Vega: OTTHUMG00000153339
Pharos: Q8NDX1(Tdark)
UniProt: Q8NDX1
LinkDB All DBs
Position
2q14.1
AA seq 1056 aa AA seqDB search
MMGDYRLPDHPQPMEILNLYLGDSLEPHPGECPRETCSHEDPPEPFEEQTWATDPPEPTR
QNVPPWGSGVELTHLGSWVHQDGLEPCQEQTRATDPPESTRQDAPPWGSGVELTHLGSPS
AQREHRQNTASPGSPVNSHLPGSPKQNRSTSTQVVFWAGILQAQMCVLDLEEELEKTEGL
KAGLKCCLPTPPVDLPGDTGLHSSPPENEDSGEDSSEPEGEGQAWLREGTPDSSPQWGAE
EESMFFSNPLFLASPCSENSASGECFSWGASDSHAGVRTGPESPATLEPPLPEDTVLWEL
ESEPDLGDGAAISGHCTPPFPVPIYKPHSICWASVAAAEGAPAAPPGHGESEGDRLGPAP
SAAPCVDEALTWESGCVGSDLGPAAHPVQPWASLSPEGWQRGGPFWPQVTLNSQDRDERE
GGHPQESLPCTLAPCPWRSPASSPEPSSPESESRGPGPRPSPASSQEGSPQLQHHSSGIL
PKWTLDASQSSLLETDGEQPSSLKKKEAGEAPKPGEEVKSEGTARPAETGDVQPDIHLTS
AEHENLRTPMNSSWLPGSPMPQAQSPEEGQRPPAGDKLANGVRNNKVAWNLASRLYRLEG
FRKSEVAAYLQKNNDFSRAVAEEYLSFFQFGGQSLDRALRSFLQALVLSGETQERERILY
QFSRRFHHCNPGIFPSVDSVHTLTCAIMLLNTDLHGQNIGKSMSCQEFITNLNGLRDGGN
FPKELLKALYWSIRSEKLEWAVDEEDTARPEKAQPSLPAGKMSKPFLQLAQDPTVPTYKQ
GILARKMHQDADGKKTPWGKRGWKMFHTLLRGMVLYFLKQGEDHCLEGESLVGQMVDEPV
GVHHSLATPATHYTKKPHVFQLRTADWRLYLFQAPTAKEMSSWIARINLAAATHSAPPFP
AAVGSQRRFVRPILPVGPAQSSLEEQHRSHENCLDAAADDLLDLQRNLPERRGRGRELEE
HRLRKEYLEYEKTRYETYVQLLVARLHCPSDALDLWEEQLGREAGGTREPKLSLKKSHSS
PSLHQDEAPTTAKVKRNISERRTYRKIIPKRNRNQL
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtgactacagactccctgaccacccccagcccatggaaattctcaacctgtac
ttgggagacagcctggagccccacccaggagagtgcccaagggaaacgtgcagccatgag
gatccaccggagcctttcgaggagcaaacctgggccactgaccctcctgaacctaccaga
caaaatgttcctccctggggctccggtgtggagctcacacacctggggagctgggtccat
caggacgggctggagccttgccaggagcaaacccgggccactgaccctcctgaatctacc
agacaagatgctcctccctggggctccggtgtggagctcacacacctggggagcccctct
gcccagagggagcacaggcagaacacagcatcaccagggtcaccagtgaacagccatcta
ccggggagcccaaagcagaaccggagcacgtccacacaggtagtgttctgggcaggcatc
ctgcaggcccagatgtgtgtcctagacctggaggaggagctggagaagacggaagggctc
aaggctgggctgaaatgctgtctccccacgccccctgtggacctccccggggacacgggc
ctgcactccagcccacctgagaatgaagactcaggggaagacagcagtgagcctgaggga
gagggccaggcatggctgagagagggaaccccagactcttccccacagtggggagctgag
gaggagagcatgttcttcagcaaccccctcttcctggcgagtccttgctcagagaacagt
gcttctggagagtgcttttcctggggggcttcagactcccatgcaggtgtgaggactgga
cctgagagcccagcgactctggagcctcccctcccagaagacacagtgctgtgggagctg
gaaagtgagccagatttgggggacggcgctgctatcagtgggcattgtacccctccattc
cctgtgcccatctataaaccacactccatctgctgggcctcagtggctgccgctgagggg
gctcctgcagcacctcctggtcacggggagagtgagggagataggcttggtcctgctcca
tctgcagcaccgtgtgtggacgaagcattgacctgggaatcaggatgtgtcggatctgat
cttggccctgctgcacatcctgtgcaaccttgggcctctctcagccctgagggctggcag
agaggaggtcctttttggccccaggtgactcttaactcccaggacagagatgagagggag
ggtggacacccccaggaatctcttccctgcaccttggccccctgcccctggaggagccca
gcttcttctccagagcctagcagcccagaatctgagagcagaggccctggtcccaggccc
agccctgcatcgtcccaggagggcagcccgcagcttcaacaccacagctcaggcattttg
cccaagtggacactagatgcttcacagtcttcactcttggagacggatggggaacagcca
agttccttgaagaaaaaggaggcaggggaggccccaaaaccaggcgaggaagtaaagagt
gaaggaacagccaggcctgcagagactggagacgtccagcctgacattcacctgacttct
gcagaacatgagaatctgaggacaccgatgaactcttcttggcttcctgggagccctatg
ccccaagcacagtccccagaggaaggccagagaccaccagctggagacaagctagctaat
ggcgtcaggaacaacaaggtagcctggaacttggcctcacgcctctatcgcctggagggc
ttccggaagtctgaagtggctgcctacctgcagaagaacaatgactttagcagggctgtg
gctgaggagtacctgtccttcttccagtttggaggccagagtctggaccgagccctccgg
agcttcctccaggccttggtgctcagtggggagactcaggaacgggagcgaatcctctac
cagttctccagacgcttccaccattgcaatccggggatcttcccctcagtagattctgta
cacaccttgacatgtgcaatcatgctgcttaacacggacctgcatggacagaacattggg
aagagcatgagctgccaggaattcataaccaacctgaatgggctgagggatggcgggaac
ttccccaaggagctgctgaaggccctctactggtctatccgcagcgagaagctcgagtgg
gccgtggatgaagaagacacagccagacctgagaaggcccagccgtccctgccagctggc
aagatgagcaagcccttccttcagctggctcaggatcccacagtgcccacctacaagcag
ggcatcctggctcggaaaatgcatcaagatgcagacggcaagaagacgccatggggcaag
cgtggctggaagatgttccacaccttactgcgagggatggttctctacttcctgaagcag
ggagaagaccactgtctggagggggagagcttggtggggcagatggtggatgagcccgtg
ggggtgcaccactcgctggccacccccgccacgcattacaccaagaagccgcacgtcttc
cagctgcgcacggctgactggcgcctctacctcttccaggcacccactgccaaggagatg
agctcctggatcgcgcgcatcaacttggctgcggccacgcactccgcgccgcccttcccc
gccgctgtgggctcccagcgcagattcgtgcggcccatcctgcccgtgggccccgcccag
agctccctggaggagcagcatcgatcccacgagaactgcctggacgctgccgcggacgac
ctgctggatctacagaggaacctgccggagcggcggggccgtggccgcgagctggaggag
caccgcctgcggaaggagtacctggagtacgagaaaacccgctacgagacctacgtgcag
ctgctggtggcccgcctgcactgcccctctgatgctctggacctgtgggaggagcagctg
gggagggaagctggaggcactcgggagcccaagctcagcctgaagaagtcccactcgagc
ccgtccctgcaccaggatgaggctcccaccacggccaaggtgaagcgcaacatctcagag
cgcagaacctaccggaagatcatccctaagcggaaccgcaatcagctgtga

KEGG   Homo sapiens (human): 27128Help
Entry
27128             CDS       T01001                                 

Gene name
CYTH4, CYT4, DJ63G5.1, PSCD4, cytohesin-4
Definition
(RefSeq) cytohesin 4
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    27128 (CYTH4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27128 (CYTH4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27128 (CYTH4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    27128 (CYTH4)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    27128 (CYTH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_3 PH_8 MazG
Motif
Other DBs
NCBI-GeneID: 27128
NCBI-ProteinID: NP_037517
OMIM: 606514
HGNC: 9505
Ensembl: ENSG00000100055
Vega: OTTHUMG00000150562
Pharos: Q9UIA0(Tbio)
UniProt: Q9UIA0
LinkDB All DBs
Position
22q13.1
AA seq 394 aa AA seqDB search
MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQ
KEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDP
INLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQ
STDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPR
GIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSA
EERDQWIESIRASITRVPFYDLVSTRKKKIASKQ
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtgccacccagagcccgcggagctgagcagcggggagacggaagagttacag
aggatcaagtggcaccgaaagcagctcctggaggacatccagaagctgaaggatgagatt
gcagatgtgtttgcccaaatcgactgcttcgagagtgcggaggagagccggatggcccag
aaggagaaggagctgtgtattgggcgcaagaagttcaacatggaccccgccaagggtatc
cagtatttcattgagcacaagctgctgacccctgacgtccaggacattgcacggttcctg
tataaaggcgagggcctcaacaagacagccattggtacctacctgggggagagggatccc
atcaacctgcaggtcctccaggccttcgtggactgccacgagttcgccaacctcaacctc
gtccaggccctcaggcagttcctgtggagcttccggctgccgggcgaggcccagaagata
gaccggatgatggaggcctttgccactcgatactgcctctgcaacccaggcgtcttccag
tccacagacacctgctacgtgttgtccttctccatcatcatgctcaacaccagcctccac
aatcccaacgtccgggacaggccgccttttgagcgctttgtgtccatgaaccgcggcatc
aacaatggtagcgacctgcccgaggaccagctgcggaacctcttcgacagcatcaagagt
gagccattctccatccctgaggacgacggcaatgacctcactcacaccttcttcaatcca
gaccgggagggttggctgctcaagctagggggccgcgtgaagacgtggaaacggcgctgg
ttcatcctgaccgacaactgcctctactacttcgagttcaccactgacaaggagccacgg
ggaattatacctcttgagaacctctcggtgcagaaggtggatgaccccaagaagccattc
tgcctggagctctacaaccctagctgccgaggccagaaaatcaaggcctgcaagaccgat
ggcgacggcagggtggtggagggcaagcacgaatcgtaccgcatctcagccaccagtgcc
gaggaacgtgaccagtggatcgagtccatccgagccagcatcacccgtgtccccttctac
gacctggtctctactcggaagaagaagattgccagcaagcagtga

KEGG   Homo sapiens (human): 440073Help
Entry
440073            CDS       T01001                                 

Gene name
IQSEC3
Definition
(RefSeq) IQ motif and Sec7 domain 3
  KO
K12495  IQ motif and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    440073 (IQSEC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    440073 (IQSEC3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    440073 (IQSEC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 IQ_SEC7_PH bZIP_1 SlyX IQ
Motif
Other DBs
NCBI-GeneID: 440073
NCBI-ProteinID: NP_001164209
OMIM: 612118
HGNC: 29193
Ensembl: ENSG00000120645
Vega: OTTHUMG00000167975
Pharos: Q9UPP2(Tdark)
UniProt: Q9UPP2
LinkDB All DBs
Position
12p13.33
AA seq 1182 aa AA seqDB search
MESLLENPVRAVLYLKELTAIVQNQQSLIHTQRERIDELERRLDELSAENRSLWEHQQLL
QAQPPPGLVPPSSAPLPAAPATAPAAAARAQEPLQDQGQRSAAAPHPAPDRPPRQHHGQL
LEQPQRGPGSRAHTPQSPHKHLGTQGAVTDKEKERPPSCCAAAGALLQHKSPSALGKGVL
SRRPENETVLHQFCCPAADACSDLASQSDGSCTQAGGGMEDSVVAAAAVAAGRPSAHAPK
AQAQELQEEEERPGAGAASPRAGPQHKASPGRQQPALATALCPHAPAASDYELSLDLKNK
QIEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRSPT
AESLAAEKALMEGYGLVGLPLVRSPSLPPTFAGTLTELEDSFTEQVQSLAKSIDDALSTW
SLKTMCSLRESGAYQLHQALQAAAGPPGLEAEGRAPESAGPGPGDDAAETPGLPPAHSGT
LMMAFRDVTVQIANQNISVSSSTALSVANCLGAQTVQAPAEPAAGKAEQGETSGREAPEA
PAVGREDASAEDSCAEAAASGAADGATAPKTEEEEEEEETAEVGRGAEAEAGDLEQLSSS
STSTKSAKSGSEASASASKDALQAMILSLPRYHCENPASCKSPTLSTDTLRKRLYRIGLN
LFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCV
VDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIF
ILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELK
SNEDHVTYVTKVEKSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFND
LLVILKLCPKKKSSSTYTFCKSVGLLGMQFQLFENEYYSHGITLVTPLSGSEKKQVLHFC
ALGSDEMQKFVEDLKESIAEVTELEQIRIEWELEKQQGTKTLSFKPCGAQGDPQSKQGSP
TAKREAALRERPAESTVEVSIHNRLQTSQHNSGLGAERGAPVPPPDLQPSPPRQQTPPLP
PPPPTPPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALSCYTSSSSDSCGSTPLGGPGSP
VKVTHQPPLPPPPPPYNHPHQFCPPGSLLHGHRYSSGSRSLV
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgctggagaatccggtgcgcgccgtgctctacctcaaggagctcacggcc
atcgtgcagaaccagcagagcctcatccacacccagcgagagcgtatcgacgagctggag
cggcggctggacgagctgagcgctgagaaccgcagcctgtgggagcaccagcagctgctg
caagcccagcctccgcccgggctcgtccccccgtcatcggccccgctgccggccgctccg
gccaccgctcctgccgccgccgccagggcccaggaacctctccaggaccagggacagcgc
tcagcagccgcgccgcatcccgcgcccgatcggccgccgcgtcagcaccacggacagctc
ctggagcagccccagcggggccctggcagcagggctcacacaccccagtcgccccacaag
catctggggacacaaggggccgtgactgacaaggagaaggagcgtcccccgagttgctgc
gctgctgccggagccctccttcagcacaaatccccctccgccctcggcaagggcgtcctg
agcaggagacctgagaatgagaccgtgctgcaccagttctgctgcccagccgccgacgcc
tgctccgacctggcctcccaaagtgatggctcctgcacccaggccggtgggggcatggag
gactccgtggtggcagcggcggcggtggcagccggcagacccagtgcccatgccccgaag
gctcaagcccaggagctgcaggaggaggaggagcggccgggggcaggggctgcctcccca
agggctggcccccagcacaaggcctcccccggccggcagcagcctgccctggcgacggcg
ctgtgcccccacgcccctgccgcctccgattacgaactctcccttgacctaaagaataaa
cagattgaaatgctagaacataagtacggcggtcacctggtgtcccggcgcgccgcttgc
accatccaaaccgccttccgccaataccagctcagcaagaacttcgagaaaatccgcaac
tcgcttctggagagccgcctgccacggcggatctccctgcgcaaggtgcggtcacccacg
gccgagagcctggcggccgagaaagcgctcatggagggctacggcctcgtggggctgccg
ctggtgcgctcgccctccctgccgcccaccttcgcaggcaccctcaccgagctggaggac
tccttcaccgagcaggtgcaatccctggccaagtccatcgacgacgcgctcagcacgtgg
agcctcaagaccatgtgctccctgcgggagagtggcgcttaccagctccaccaggccctg
caggcggccgcggggcccccaggcctggaggccgaggggcgggcgccggagagcgcgggc
cccgggcccggggatgacgccgcggagacccccggcctgcccccggcccacagcgggacc
ctcatgatggctttccgggacgtcacggtgcagatcgccaaccagaacatatccgtctcc
tcctccacggctctgtcggtggccaactgcctgggcgctcagacggtccaggcccccgca
gagcccgcggcgggcaaggccgagcagggcgagacctctgggcgggaggccccggaagcc
cccgccgtgggccgggaggacgcgtcagccgaggactcatgcgcagaggctgcggctagt
ggggcggcggatggggccacagcccccaaaacagaggaggaagaggaggaggaggagacg
gcggaggtggggagaggggccgaggccgaggcaggcgacttggagcagctgagcagcagc
agcacgtccaccaagtccgccaagtcaggctcggaggcgtcggcctccgcctccaaggac
gccctgcaggccatgatcctgagcctgccgcgctaccactgcgagaacccagccagctgc
aagtcgcccacgctctccaccgacaccctgcgcaagcggctctaccgcatcggcctcaac
ctcttcaacataaaccccgacaagggcatccagttcctgatctcacgcggcttcatcccg
gacacccccatcggtgtggcccatttcctcctccagcgaaagggcctcagccgccagatg
attggagagttcctgggcaacagcaagaagcagttcaaccgcgacgtgctggactgcgtg
gtggacgagatggacttctccagcatggagctggacgaggccctgcgcaagttccaggca
cacatccgtgtgcagggggaggctcagaaggtggagcggctcattgaggccttcagccag
cgctactgcatgtgcaaccccgaagtggttcagcagttccacaaccccgacaccatcttc
atcctcgccttcgccatcatcctcctcaacaccgacatgtacagccccaacatcaagcct
gaccggaagatgatgctggaggacttcatccgaaaccttcgaggtgtggacgatggcgct
gacatccccagggagctggtggtaggcatctatgagaggatacagcagaaggagctcaag
tccaatgaggaccacgtcacgtacgtcaccaaggtggagaagtccattgtgggcatgaag
acagtgctgtccgtgccccaccgccgcctggtgtgctgcagccggctcttcgaggtgacg
gatgtgaacaagctgcagaagcaggcagcgcatcagagggaggtgttcctcttcaatgac
ctgctggtgattctcaaactttgcccgaagaagaagagctcctccacgtacaccttttgc
aagtcagttggcctgctgggcatgcagttccagctctttgagaacgagtattactctcat
ggcatcacactggtgaccccgctctcgggctccgagaagaagcaggtgctgcatttctgt
gccctgggctcggacgagatgcagaagttcgtggaggacctgaaggagtccattgctgag
gtgacggagctggagcagatccgaatagagtgggagctggagaagcagcagggaacaaag
acactctccttcaagccctgcggagcccagggggacccacagtcaaagcaaggatcgccg
acagccaaaagggaagccgcgctcagggagaggccggcggagagcacggtggaggtgtca
attcacaacaggcttcaaacgtcccagcacaactccgggctgggggccgagaggggagcg
ccggtgccgccgccagacctgcagcctagccccccgagacagcagaccccaccactgccg
ccgccgccacccacgcccccgggcaccctggtgcagtgccagcaaattgtcaaggtcatt
gtcctggacaagccctgcctggcccgcatggagcccctgctgagccaggctctctcctgc
tacacctcgtcgtcctctgactcctgcggctccacacccctgggcggtcccggctctccg
gtcaaggtcacccaccagcctccgctgcccccgcccccacccccctacaaccaccctcac
cagttctgtcccccaggctccctgctgcacgggcaccgctactccagtggctcaaggagc
ctggtgtag

KEGG   Homo sapiens (human): 5662Help
Entry
5662              CDS       T01001                                 

Gene name
PSD, EFA6, EFA6A, PSD1, TYL
Definition
(RefSeq) pleckstrin and Sec7 domain containing
  KO
K12494  PH and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5662 (PSD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5662 (PSD)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    5662 (PSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH_9 PH
Motif
Other DBs
NCBI-GeneID: 5662
NCBI-ProteinID: NP_001257894
OMIM: 602327
HGNC: 9507
Ensembl: ENSG00000059915
Vega: OTTHUMG00000018954
Pharos: A5PKW4(Tbio)
UniProt: A5PKW4
LinkDB All DBs
Position
10q24.32
AA seq 1024 aa AA seqDB search
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGREL
GRVTAPCTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVIFRFVEKASVRPLNGLPAP
GGLSRSWDLGGVSPPRPTPALGPGSNRKLRLEASTSDPLPARGGSALPGSRNLVHGPPAP
PQVGADGLYSSLPNGLGGPPERLATLFGGPADTGFLNQGDTWSSPREVSSHAQRIARAKW
EFFYGSLDPPSSGAKPPEQAPPSPPGVGSRQGSGVAVGRAAKYSETDLDTVPLRCYRETD
IDEVLAEREEADSAIESQPSSEGPPGTAYPPAPRPGPLPGPHPSLGSGNEDEDDDEAGGE
EDVDDEVFEASEGARPGSRMPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKGTSY
TSLASLEALASPGPTQSPFFTFELPPQPPAPRPDPPAPAPLAPLEPDSGTSSAADGPWTQ
RGEEEEAEARAKLAPGREPPSPCHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLA
LGSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVF
TGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLL
NTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRS
LSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGK
RGWKSFHGILKGMILYLQKEEYKPGKALSETELKNAISIHHALATRASDYSKRPHVFYLR
TADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQ
EEQVRTHEAKLKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLR
VKLKAGSEELDAVEAALAQAGSTEDGLPPSHSSPSLQPKPSSQPRAQRHSSEPRPGAGSG
RRKP
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atggcccagggtgccatgcgcttctgctcggaaggcgactgtgccatctccccaccacga
tgcccacgccgctggctccccgaaggcccggtgccccagagccccccagccagcatgtat
ggcagcacaggctccttgctacggcgagtggcaggtccaggtcctcgaggccgggaactg
ggacgtgtgacagcaccctgtacacctctgcgtggccccccctcaccccgtgttgctccc
tcaccctgggcaccctcttcacccactgggcagcccccacccggggcccagagctctgtg
gtcatcttccgctttgtggagaaggccagtgtgaggccactgaatgggctacctgctcca
gggggcttgagtcggagctgggatctgggtggggtttctcctcccaggcccaccccagcc
cttgggcctggctccaaccggaagttacggctggaagcatccacatcagacccactcccc
gccagaggaggctcggccctacctggcagccggaaccttgtacatgggccgccagcccca
ccccaggttggagcagatggcctttactcctctctccccaatgggctggggggcccccct
gagcgcctggccacactcttcggaggacctgctgacactggattcctgaaccagggggat
acctggtcctccccccgggaagtctcctctcatgcccagagaatcgctagagccaaatgg
gaattcttctatggctccttggacccccccagctcaggtgctaagcccccagagcaggcc
cccccatctccacctggggtgggctcaaggcagggctctggggtggctgtggggcgagca
gccaagtactccgagacagacctggacacggtgcccctgaggtgctaccgcgagactgac
atcgatgaggtgctggctgagcgggaggaggccgactcggccatcgaaagtcagcccagc
tctgagggcccaccaggcactgcctacccacctgccccacggcccggcccactccctggc
cctcatcccagcctcggcagtggcaatgaggatgaggacgacgatgaggcaggtggggaa
gaagatgtggacgacgaggtgtttgaggcctctgaaggggcccggccagggagccggatg
cctctcaagtcacctgtgccctttctacctgggacgagcccctcggctgatgggcctgac
tctttcagttgtgtgttcgaagccatcctggagtcacaccgggccaaaggcacctcctat
accagcctcgcctcgctggaggccttggcctcacctggcccaacccagagccccttcttc
acctttgagctgcctccccaaccccctgcaccccggcccgacccaccagctcccgcccca
cttgcccctcttgaaccggattctggtaccagctctgctgctgatggtccttggacacag
agaggggaggaggaggaggcagaggccagagccaagctggccccagggagggagccccct
agtccctgccactcagaggacagccttgggctgggggcagcaccccttggcagcgaacca
cccctgagccagctggtgtccgactcagactcagagctggacagcacagagcggctggcc
ctgggaagcacagacaccttgtccaatgggcagaaagcggacctggaggctgcgcagcgc
ctggccaagaggctgtaccgactagatggcttcaggaaggccgatgtggcccggcacctg
ggcaagaacaatgacttcagcaaactggtggctggggagtacctcaagttctttgtcttc
acgggcatgactctggaccaagctctcagggtgtttctgaaggagctggccttaatgggt
gagacccaggaacgagagcgcgtgctggcccacttctcccagcgatacttccagtgcaat
cctgaagccctgtcctcagaggacggcgcccacacgctgacctgtgcgctcatgctgctc
aacacggatctccacggccataacatcgggaagcgcatgacctgcggggacttcatcggg
aacctggagggcctcaatgatggcggcgacttccctagggagctgctcaaggccttgtac
agctccatcaagaatgagaagctgcagtgggccatagacgaggaggagctgagacgctct
ctgtctgagttggccgaccccaaccccaaggtcatcaagcggatcagcgggggcagtggc
agtggctccagccctttcctggacctgactcccgagcctggggctgccgtctacaagcac
ggggccctggtgcgaaaggtgcacgcagaccctgactgcaggaagacacctcggggcaag
cggggctggaagagcttccacgggatcctcaagggcatgatcctctacctgcagaaggag
gagtacaagcctgggaaggccctttcagagacggagctcaagaatgccatcagcatccac
catgccctggccactcgtgccagtgactacagcaagaggccccacgtcttctacctgcgc
acagctgactggcgggtcttcctcttccaggccccgagcctggagcagatgcagtcctgg
atcactcgcatcaatgtagtagccgctatgttctctgcgccccccttcccagctgctgtt
agctcccaaaagaagttcagccgccctctcctgcccagcgctgccacccgcctctcccag
gaggagcaggtgcggacccacgaggccaagctgaaggccatggcaagtgagctgcgggag
caccgggccgcccagctgggcaagaagggccggggcaaggaggctgaagagcagcggcag
aaggaggcctacctggagtttgagaaatcccgctacagcacctatgcagcgctgcttcgg
gtcaagctgaaggcaggcagtgaggagctggatgcagtggaggcagcactggcccaggcc
gggagcacagaggatggactccctccttctcactccagtccctccctgcagcccaaaccc
tccagccagccccgggctcagcgtcacagctcagagcctcggccaggggcaggcagtggg
cggcggaagccctga

KEGG   Homo sapiens (human): 84249Help
Entry
84249             CDS       T01001                                 

Gene name
PSD2, EFA6C
Definition
(RefSeq) pleckstrin and Sec7 domain containing 2
  KO
K12494  PH and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84249 (PSD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84249 (PSD2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    84249 (PSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH_9 PH COBRA1
Motif
Other DBs
NCBI-GeneID: 84249
NCBI-ProteinID: NP_115665
HGNC: 19092
Ensembl: ENSG00000146005
Vega: OTTHUMG00000129240
Pharos: Q9BQI7(Tdark)
UniProt: Q9BQI7
LinkDB All DBs
Position
5q31.2
AA seq 771 aa AA seqDB search
MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEP
TKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAED
PQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPL
TPLIQQRARDSPEPGAGLGIGDMAFEGDMGAAGGDGELGSPLRRSISSSRSENVLSRLSL
MAMPNGFHEDGPQGPGGDEDDDEEDTDKLLNSASDPSLKDGLSDSDSELSSSEGLEPGSA
DPLANGCQGVSEAAHRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLT
LDGALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDL
HGHNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSEL
VDDKFGTGTKKVTRILDGGNPFLDVPQALSATTYKHGVLTRKTHADMDGKRTPRGRRGWK
KFYAVLKGTILYLQKDEYRPDKALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADW
RVFLFQAPSKEEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRLCQEEQL
RSHENKLRQLTAELAEHRCHPVERGIKSKEAEEYRLKEHYLTFEKSRYETYIHLLAMKIK
VGSDDLERIEARLATLEGDDPSLRKTHSSPALSQGHVTGSKTTKDATGPDT
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacaagctcttatctgcagtgcctgaggaaggcgatgccacccgtgacccc
ggtccagagcctgaagaggagccaggggtccggaatgggatggccagtgagggcctgaac
agcagcctctgcagcccagggcacgagcgaaggggcaccccagcggacactgaggaaccc
acgaaggacccagatgtggccttccatggcctcagccttggcctctctctcaccaatggc
ctagccctggggccagacttgaacattctggaagattcagcggagtccaggccctggagg
gctggcgtgctggcagagggggacaatgcttccaggagcctctacccagatgctgaggac
cctcagctggggttggatggtcccggggagccagatgtgcgggatggcttcagcgccacg
tttgagaagattctggagtcagagctgctgcggggcacccagtacagcagcctcgactcc
ctagacgggctgagcctcacggatgagagcgacagctgcgtcagcttcgaggcccccctc
acacccctcatccagcagcgggcccgtgacagccctgagccaggggctgggttgggcatt
ggggacatggcgtttgagggggacatgggggcagctggtggtgatggggagctgggcagc
cccctgcggcgctccatctccagcagccgctctgagaatgtcctgagccgcctgtctctc
atggccatgcccaatggattccatgaagatggccctcagggcccagggggggatgaggat
gatgatgaggaggacacggacaagttgctgaactcagccagtgaccccagcctgaaggat
ggcctgtcagactcagactctgagctcagcagctcggaggggttggagcctggtagtgca
gaccctctggccaacgggtgccagggggtcagtgaagctgctcatcggctggcacgccgt
ctctaccacctcgagggcttccagcgctgtgatgtggcccggcagctgggcaagaacaac
gagtttagcaggctggtggccggggagtacctcagtttcttcgacttctcgggcttgact
ctggacggagcactcagaacattcttgaaggccttcccgctgatgggggagacacaagag
cgtgagcgggtcctcacacacttctcccgccggtactgccagtgcaaccctgatgacagc
acttcggaagatgggatccacacgctcacctgtgccctgatgctgctcaacacggacctg
cacggccacaacattggcaaaaagatgtcctgtcagcaattcattgccaacttggaccag
ctgaatgatggccaagactttgccaaagacctgctgaagaccctttacaactccatcaag
aatgaaaagctggaatgggccattgatgaggatgagctgaggaaatccctgtctgagctg
gtggatgacaagttcgggacaggcacgaagaaggtgacgcgaatcctggatggtggcaac
cccttcctggatgtcccacaggcgctcagtgccaccacctacaagcacggcgtcctgacc
cggaagactcacgctgacatggatggcaagaggacgccccgtgggaggcgtggctggaag
aaattctacgcagtgctcaaagggaccatcctgtacctgcagaaggatgagtacaggcct
gacaaagctctatcggagggtgacctgaagaacgccattcgcgtgcatcacgctctggcc
accagggcctctgactacagcaagaagtccaacgtgctgaagcttaagacagccgactgg
agggtattcctcttccaggcaccgagcaaggaagaaatgctgtcctggatcctcaggatc
aacctggtggcagccatcttctctgccccggccttcccagccgctgtcagctccatgaag
aagttctgtcggcccctgctgccctcctgcaccacccgcctctgccaggaggagcaactg
cggtctcatgagaataagttgaggcagctgactgcggagctggccgaacacaggtgtcac
ccagtcgagaggggcatcaagtccaaggaggccgaggagtaccggttgaaggagcactat
ctcaccttcgagaaaagccgttatgagacctatatccacctcctggctatgaaaatcaaa
gtgggctcagatgatctggagcggattgaggcccggctggccactctggaaggggatgac
ccttctctccggaagacacattcaagccctgccctcagccagggccatgtgactggcagc
aaaaccacaaaggatgccactgggcctgatacttag

KEGG   Homo sapiens (human): 8729Help
Entry
8729              CDS       T01001                                 

Gene name
GBF1, ARF1GEF
Definition
(RefSeq) golgi brefeldin A resistant guanine nucleotide exchange factor 1
  KO
K18443  golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8729 (GBF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8729 (GBF1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    8729 (GBF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 Sec7_N DUF758 DUF1045
Motif
Other DBs
NCBI-GeneID: 8729
NCBI-ProteinID: NP_004184
OMIM: 603698
HGNC: 4181
Ensembl: ENSG00000107862
Vega: OTTHUMG00000018955
Pharos: Q92538(Tbio)
UniProt: Q92538
LinkDB All DBs
Position
10q24.32
AA seq 1859 aa AA seqDB search
MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIE
PNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGMENMADAVTHAR
FVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKS
AEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMRAGGMSDSSKWKKQKRSPRPPRHM
TKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQT
TSKEDLTDLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEEC
TSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR
HNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVC
FLLFESMREHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYI
NYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQAKVLNSL
TQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSG
CSDLEEAVDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQF
LQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDE
ALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNH
NVRKQNAPMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVW
NVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRK
CAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHG
DILREGWKNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFV
SWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPEKMITESKFLQLESLQELMKALVS
VTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAV
VGLLRLAIRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSG
DDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQSDSELPSYHQNDVSLDRGYTSDS
EVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLD
LGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSH
KYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDDDEDEGVPASYHTVSLQVSQDLLD
LMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQV
RMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRAS
TLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSSDLLSEAIPESLKNMLLVMDT
AEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAH
LTSAAGDTRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGP
PPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEATSPVPLLATPRPTDPIPTSEVN
NT seq 5580 nt NT seq  +upstreamnt  +downstreamnt
atggtggataagaatatttacatcattcaaggggagattaacattgtggttggggccatc
aaacgaaatgcccgatggagcacccatacaccactggatgaagaacgggatcctctgctg
catagtttcggtcatctaaaggaggttttaaacagtataacagaactctcagaaattgag
cccaatgtattccttcgaccttttctggaagtgattcgctctgaagataccactggccct
atcactggactggcactcacctctgtcaacaagttcctgtcctatgcactcatagatccc
acccatgagggcacagcagagggcatggagaacatggcagatgctgtcacccatgctcgt
tttgtgggcacggatcctgccagtgatgaagttgtcctgatgaaaatccttcaggttcta
cggactctgctgctaaccccagtgggtgcccacctaaccaatgaatctgtgtgtgagatt
atgcagtcttgcttccggatctgctttgaaatgaggctcagtgagttattgagaaaatcc
gcagagcacactctcgtagacatggtgcagctgctcttcacaaggttacctcagtttaaa
gaagaacccaagaactatgtggggaccaacatgaagaagctgaaaatgagagccggaggc
atgagtgattcatccaaatggaagaaacagaagagatcccctcggcccccacgccatatg
accaaagtcacaccaggttcagagctgcccactcccaatggaaccaccttatcatctaac
ctcactggtggcatgcccttcattgatgtgcccactcccatctcctctgcaagttcagaa
gctgcctcagcagtggtcagtccctctacagacagtggcctggaattctcctcccaaacc
acttccaaggaagaccttactgatctagagcaacctggctctccagggtacagcacagct
acagagcctggaagcagtgagctaggtgttcccgagcagcctgacctccaggaagggacc
catgtggaaaagtcccagtcagcatctgtggagtccatccctgaagtgttagaggagtgc
acgtcccctgccgaccactctgactctgcctctgtccatgacatggattacgtcaatccc
cggggcgtgcgctttacacagtcctcccagaaagaaggcacagctttggtcccctatggt
cttccctgcatccgcgagctcttccgcttcctcatctccctcaccaatccacacgaccgc
cataactcagaggttatgattcacatgggactgcatttgctgacagtggcccttgagtca
gcccctgtagcccagtgccagaccctcttgggcctcatcaaggatgagatgtgccgtcac
ttattccagctactcagcatagagcgactaaacctttatgctgcttccctgcgagtatgc
ttcctactgtttgagagcatgcgagagcacctcaagttccaaatggagatgtacatcaaa
aagcttatggagatcatcactgtggagaaccccaagatgccttatgagatgaaggagatg
gcactggaggccattgtgcagctctggcgcatccccagctttgtcacagagctctacatc
aactatgattgtgactactactgttccaacctctttgaggaactcacaaagctgctgtcc
aagaatgccttccctgtgtctggtcaactctatacaacacacctactatctcttgatgcc
ctattgacagtgattgacagcaccgaggcccactgccaggctaaagtcctcaacagcctc
acccagcaagagaagaaggagacagccagaccaagctgtgagatagtagatggcacccga
gaagctagcaatactgagagaactgccagcgatgggaaagctgtaggcatggcctcagac
atcccaggcctgcatctgccaggtggagggcggctgccaccagaacatgggaaatcagga
tgcagtgatctggaggaagctgttgactctggggctgacaaaaagtttgcccggaagcca
ccccgattttcctgtctcctgccagatccacgggaactaattgaaattaaaaacaaaaag
aagctgctaatcactggcacagagcagttcaatcagaaaccaaagaaggggattcagttt
ctgcaagagaaaggcctcctcaccatcccaatggacaacacagaggttgctcagtggctc
cgagagaaccctcggctggacaagaagatgattggagagtttgtgagtgaccgcaaaaac
attgacctgttggagagctttgtgagcaccttcagttttcagggtctgcgactggacgaa
gccctccgcctctacctggaagccttccgtttgcctggggaagcaccagtcatccagagg
ttgctggaggcattcacagagcgttggatgaattgtaatggctccccatttgccaatagc
gatgcctgcttttccctggcctatgctgtcatcatgcttaatactgaccagcacaaccac
aatgttcgtaaacagaatgcacccatgaccctggaggagtttcgcaaaaatctgaaaggt
gtgaatggaggcaaggactttgagcaagacatcctggaggacatgtaccatgccatcaag
aatgaggaaattgtaatgcctgaggagcagacaggcttggttcgggagaactatgtgtgg
aatgtgctgcttcatcgaggtgccacccctgagggcatattcctgcgtgtgcctactgcc
agctatgatcttgacctcttcaccatgacctggggccccactattgctgctctctcttat
gtctttgacaaaagccttgaggagacaatcatccagaaagccatctcaggcttcaggaag
tgcgccatgatctccgcccactatggcctcagcgatgtgtttgacaatctcatcatctct
ctatgcaaattcacagctctcagcagtgagtctattgagaacctgcccagtgtatttgga
agcaaccctaaagcccatattgcagccaagacagtattccatttggcccatcgtcatggt
gacatcctgcgggagggctggaagaatatcatggaggccatgctgcagctcttccgagcc
caactactgcccaaggctatgatagaggtagaagatttcgtggatcccaatggcaagatc
tctctacagcgggaagagacaccatcaaaccgaggagagtcaacagtgctgagctttgtg
agctggctaacactgagtggtcctgagcagtctagtgttcggggcccatccactgaaaac
caagaggccaagagagtggccttagagtgtataaagcaatgtgacccagaaaaaatgatc
acagaaagcaagttcctccagctggagtcactacaggagctcatgaaggctctggtctca
gtgacaccagatgaagagacatatgatgaggaagatgctgctttctgcctagagatgctg
ctaaggattgtgttggagaacagggatcgtgtgggctgtgtgtggcagactgttcgagac
catctataccacctctgtgttcaggcacaagatttctgcttccttgtggagcgggcagtg
gtggggttgctacgcctggccattcggcttctccggagagaagagatcagtgctcaggtg
ctgctctccctgcgcattttgctactgatgaagcccagtgtgctatcccgagtcagccac
caggttgcgtatgggctccatgaactcctgaagaccaatgcagccaacatccactcaggt
gatgactgggccacactcttcacactgctggagtgcatcggctcaggtgtgaagcctcca
gctgctctgcaggccacagccagggcagatgcacctgatgccggggcccagtcagatagt
gagctcccatcctaccatcagaatgacgtgagcctggatcgagggtacacttccgactca
gaggtctacactgaccatggcaggccgggcaagatacaccgatcagccacagatgccgat
gtggtcaacagtggttggttagtggttgggaaggatgacgttgataactccaagccaggg
cccagccgcccaggcccttcacccctgatcaatcaatacagcctaacagtgggactggat
ttggggccacacgacactaagtctctgcttaagtgtgtggaatcgctgtccttcatcgtg
cgtgatgctgcccacatcacacctgacaactttgagctctgcgtcaagactctccggatc
tttgtggaggccagtctgaatggcggatgcaagtcccaggagaaacgtggcaagagtcac
aaatatgacagcaaagggaaccgcttcaagaagaaatccaaagagggatcaatgcttcgc
cggcctcgaacctccagccaacatgcctctcggggcgggcagagtgatgatgatgaggac
gaaggcgtgcctgccagctaccatacggtgtctttacaggtcagtcaggacttgctagac
ctgatgcacaccctgcacacgcgggcagcctctatctacagctcatgggcggaggagcaa
cgccacctggagacaggtggccagaagattgaagctgattctcgcaccctctgggcccac
tgctggtgccctttactgcagggtattgcctgcctgtgctgcgatgcccggcgccaggta
cggatgcaggcactgacctatctgcagcgagcactacttgtacatgatctgcaaaagcta
gatgccctggaatgggagtcctgttttaacaaggtgctgtttcctctacttaccaagctc
ttggagaacatcagccctgcagatgtgggtgggatggaggagacccggatgagggcttcc
acattgctctctaaggtcttcctgcagcacctgtctccactgctgtcactctctaccttt
gcggccctctggctcaccatcttggacttcatggacaagtacatgcacgcaggctccagc
gacttactgtcagaggcgatccctgagtctctgaagaacatgcttctggtgatggacaca
gcggagattttccacagtgcagatgcacggggaggcggcccctcggccctctgggagatc
acctgggaacgcattgactgttttctccctcacctacgagatgaactcttcaagcagacc
gtcatccaggaccccatgcccatggagcctcaaggccaaaagcctctcgcctcagcccac
ctgacttccgctgctggcgacactaggacacctggccatccaccgcccccagagattcca
tctgagctgggggcctgtgactttgagaagcccgagagcccccgagccgccagcagcagc
tccccaggatcaccagtggcctcaagccccagcaggctgagccccacccccgacgggcct
ccacccttggctcagcccccactgatcctgcagcccttggcctccccactgcaggtgggc
gtgccacctatgactctgcccatcatcctcaaccctgcgctcatcgaggccacctcacca
gtgcccctcctggccacaccccgccccacagatcccatacccacctctgaggtcaactaa

KEGG   Homo sapiens (human): 9265Help
Entry
9265              CDS       T01001                                 

Gene name
CYTH3, ARNO3, GRP1, PSCD3, cytohesin-3
Definition
(RefSeq) cytohesin 3
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    9265 (CYTH3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9265 (CYTH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9265 (CYTH3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9265 (CYTH3)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9265 (CYTH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 SASRP1 GPS2_interact
Motif
Other DBs
NCBI-GeneID: 9265
NCBI-ProteinID: NP_004218
OMIM: 605081
HGNC: 9504
Ensembl: ENSG00000008256
Vega: OTTHUMG00000023440
Pharos: O43739(Tbio)
UniProt: O43739
LinkDB All DBs
Structure
PDB: 

Position
7p22.1
AA seq 399 aa AA seqDB search
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTT
DKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRI
SAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagacggcggcggcgagggtggtggcgtgcctgaagacctctcattagaagag
agagaagaacttctagacattcgtcgaagaaaaaaggaacttattgatgacattgagagg
ctgaaatatgaaattgcagaggtgatgacagagatcgacaatctaacttccgtagaggag
agcaaaacgactcagaggaacaaacagatagccatgggaagaaagaaattcaacatggat
cccaaaaagggaattcagtttctaatagaaaatgacctgctacagagttccccagaagac
gtcgcccagttcctttataaaggagaaggcctaaataagaccgtcattggggactacctg
ggtgaaagggatgaatttaatattaaagttcttcaagcctttgttgaactccatgagttt
gctgatctcaaccttgtacaagccttaaggcagttcttatggagcttcaggctgcccggg
gaggcgcagaagattgatcgcatgatggaggctttcgcttctcgctactgcctgtgcaac
cccggggtcttccagtccacagacacgtgctacgtgctgtcattcgccatcatcatgctc
aacaccagcctccacaaccacaacgtgcgtgacaagcccacggcagaacggttcatcgcc
atgaaccgcggcatcaacgagggcggggacctccctgaggagctgctgaggaatttgtat
gagagcattaagaacgagccatttaagatcccggaggacgacgggaacgacctgacccac
accttcttcaaccccgaccgcgagggctggctcctgaagctgggagggcgtgtgaagacc
tggaagcgccggtggttcatcctgaccgataactgcctctattactttgaatacacaaca
gataaggagcccaggggaatcatcccgttggaaaacctcagcatcagggaggtggaggac
ccccggaaacccaactgttttgagctctacaatcccagccacaaagggcaggtcatcaag
gcctgtaagactgaggccgacggccgcgtggtagaggggaaccatgtggtgtaccggatc
tcagccccgagcccggaggagaaggaggagtggatgaaatccatcaaagccagtatcagc
agagatcccttctatgacatgttggcaacgaggaaacgaaggattgccaataaaaaatag

KEGG   Homo sapiens (human): 9266Help
Entry
9266              CDS       T01001                                 

Gene name
CYTH2, ARNO, CTS18, CTS18.1, PSCD2, PSCD2L, SEC7L, Sec7p-L, Sec7p-like, cytohesin-2
Definition
(RefSeq) cytohesin 2
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    9266 (CYTH2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9266 (CYTH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9266 (CYTH2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9266 (CYTH2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9266 (CYTH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 PH_16 NUDE_C
Motif
Other DBs
NCBI-GeneID: 9266
NCBI-ProteinID: NP_059431
OMIM: 602488
HGNC: 9502
Ensembl: ENSG00000105443
Vega: OTTHUMG00000150245
Pharos: Q99418(Tbio)
UniProt: Q99418
LinkDB All DBs
Structure
PDB: 

Position
19q13.33
AA seq 400 aa AA seqDB search
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT
QEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggaggacggcgtctatgaacccccagacctgactccggaggagcggatggagctggag
aacatccggcggcggaagcaggagctgctggtggagattcagcgcctgcgggaggagctc
agtgaagccatgagcgaggtggaggggctggaggccaatgagggcagtaagaccttgcaa
cggaaccggaagatggcaatgggcaggaagaagttcaacatggaccccaagaaggggatc
cagttcttggtggagaatgaactgctgcagaacacacccgaggagatcgcccgcttcctg
tacaagggcgaggggctgaacaagacagccatcggggactacctgggggagagggaagaa
ctgaacctggcagtgctccatgcttttgtggatctgcatgagttcaccgacctcaatctg
gtgcaggccctcaggcagtttctatggagctttcgcctacccggagaggcccagaaaatt
gaccggatgatggaggccttcgcccagcgatactgcctgtgcaaccctggggttttccag
tccacagacacgtgctatgtgctgtccttcgccgtcatcatgctcaacaccagtctccac
aatcccaatgtccgggacaagccgggcctggagcgctttgtggccatgaaccggggcatc
aacgagggcggggacctgcctgaggagctgctcaggaacctgtacgacagcatccgaaat
gagcccttcaagattcctgaggatgacgggaatgacctgacccacaccttcttcaacccg
gaccgggagggctggctcctgaagctgggagggggccgggtgaagacgtggaagcggcgc
tggtttatcctcacagacaactgcctctactactttgagtacaccacggacaaggagccc
cgaggaatcatccccctggagaatctgagcatccgagaggtggacgacccccggaaaccg
aactgctttgaactttacatccccaacaacaaggggcagctcatcaaagcctgcaaaact
gaggcggacggccgagtggtggagggaaaccacatggtgtaccggatctcggcccccacg
caggaggagaaggacgagtggatcaagtccatccaggcggctgtgagtgtggaccccttc
tatgagatgctggcagcgagaaagaagcggatttcagtcaagaagaagcaggagcagccc
tga

KEGG   Homo sapiens (human): 9267Help
Entry
9267              CDS       T01001                                 

Gene name
CYTH1, B2-1, CYTOHESIN-1, D17S811E, PSCD1, SEC7
Definition
(RefSeq) cytohesin 1
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    9267 (CYTH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9267 (CYTH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9267 (CYTH1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9267 (CYTH1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9267 (CYTH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 BBS2_C GPS2_interact FapA APG6_N Pilosulin SLX9 PH_16 CEP170_C Spc7
Motif
Other DBs
NCBI-GeneID: 9267
NCBI-ProteinID: NP_004753
OMIM: 182115
HGNC: 9501
Ensembl: ENSG00000108669
Vega: OTTHUMG00000150253
Pharos: Q15438(Tbio)
UniProt: Q15438
LinkDB All DBs
Structure
PDB: 

Position
17q25.3
AA seq 398 aa AA seqDB search
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAP
TPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacgacagctacgttcccagtgacctgacagcagaggagcgtcaagaactg
gagaacatccgacggagaaaacaggagctgctggctgacattcagaggctgaaggatgag
atagcagaagtagctaatgaaattgaaaacctgggatccacagaggaaaggaaaaacatg
cagaggaacaaacaggtagccatgggcaggaaaaaatttaatatggaccctaaaaagggg
atccagttcttaatagagaacgacctcctgaagaacacttgtgaagacattgcccagttc
ttatataaaggcgaagggctcaacaagacagccatcggcgactacctaggggagagagat
gagtttaatatccaggttcttcatgcatttgtggagctgcatgagttcactgatcttaat
ctcgtccaggcactacggcagttcctgtggagcttccggctacccggagaggcccagaag
atcgaccggatgatggaggcgtttgcccagcgatattgtcagtgcaataatggcgtgttc
cagtccacggatacttgttacgtcctctcctttgccatcatcatgttgaacaccagtctg
cacaaccccaatgtcaaagataagcccactgtggagaggttcattgccatgaaccgaggc
atcaatgatgggggagacctgccggaggagctcctccggaatctctatgagagcataaaa
aatgaaccctttaaaatcccagaagacgacgggaatgacctcactcacactttcttcaat
ccagaccgagaaggctggctattgaaactcggaggtggcagggtaaagacttggaagaga
cgctggttcattctgactgacaactgcctttactactttgagtataccacggataaggag
ccccgtggaatcatccctttagagaatctgagtatccgggaagtggaggactccaaaaaa
ccaaactgctttgagctttatatccccgacaataaagaccaagttatcaaggcctgcaag
accgaggctgacgggcgggtggtggaggggaaccacactgtttaccggatctcagctccg
acgcccgaggagaaggaggagtggattaagtgcattaaagcagccatcagcagggaccct
ttctacgaaatgctcgcagcacggaaaaagaaggtctcctccacgaagcgacactga

KEGG   Homo sapiens (human): 9922Help
Entry
9922              CDS       T01001                                 

Gene name
IQSEC1, ARF-GEP100, ARFGEP100, BRAG2, GEP100
Definition
(RefSeq) IQ motif and Sec7 domain 1
  KO
K12495  IQ motif and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9922 (IQSEC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9922 (IQSEC1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9922 (IQSEC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IQ_SEC7_PH Sec7
Motif
Other DBs
NCBI-GeneID: 9922
NCBI-ProteinID: NP_055684
OMIM: 610166
HGNC: 29112
Ensembl: ENSG00000144711
Vega: OTTHUMG00000155398
Pharos: Q6DN90(Tbio)
UniProt: Q6DN90
LinkDB All DBs
Structure
PDB: 

Position
3p25.2-p25.1
AA seq 963 aa AA seqDB search
MWCLHCNSERTQSLLELELDSGVEGEAPSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEH
TSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQ
VEMLERKYGGRLVTRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFS
FEGPEKVHSSYFEGKQVSVTNDGSQLGALVSPECGDLSEPTTLKSPAPSSDFADAITELE
DAFSRQVKSLAESIDDALNCRSLHTEEAPALDAARARDTEPQTALHGMDHRKLDEMTASY
SDVTLYIDEEELSPPLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKEDKADTDTSCR
STPSLERQEQRLRVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPKH
GPHSGAPKSLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSN
DTINCSSESSSRDSLREQTLSKQTYHKEARNSWDSPAFSNDVIRKRHYRIGLNLFNKKPE
KGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFS
TMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAII
LLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNEDHVS
QVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFL
FNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLI
NFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNG
TLSRACLDDSYASGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEFQPFEPLQPSV
LCS
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgcctgcactgcaactcggagaggacccagtcccttctggagctagagcttgac
agcggcgtcgagggcgaggcccccagcagtgagactggcacatccctggacagcccctca
gcctacccccagggccccttggtgcccggttccagcctgagcccggatcactacgagcac
acgtcagtgggagcctatgggctgtactcggggccgccggggcaacagcagcgcacgcgg
aggcccaagctgcagcactcgacctccatcctgcgcaagcaggctgaggaggaggccatc
aagcgctcacgctcactctccgagagctatgagctctcctcggacctgcaggacaagcag
gtggagatgctagaacgaaagtatggggggcgcctggtaacccgccatgcggcccgcacc
atccagacggcgtttcgccagtaccagatgaacaagaacttcgagcgcttgcgcagctcc
atgtcagagaaccgcatgtcacgccggattgtgctgtccaacatgaggatgcagttctcc
tttgaggggcctgagaaagtgcacagctcctacttcgaggggaagcaggtctcagtgact
aacgacggctcccagctgggagccctggtgtcccctgagtgtggtgacctcagcgagccc
accaccctcaagtctccggccccctccagtgactttgcggacgccatcaccgagctggag
gacgccttctctaggcaagtgaaatcactggccgagtccatcgacgatgccctcaactgc
cgcagcctgcacactgaggaggcaccggccctggatgcggcgcgggcccgggacaccgaa
ccccagacagccctgcacggcatggaccaccgcaaactggacgagatgacggcctcgtac
agtgatgtcaccctgtacatcgatgaggaggagctgtcgccccctctgcccctctcgcag
gcaggggaccggccgtccagcaccgagtcggacctgcggctacgggctgggggcgcagcc
ccagactactgggccctggcccacaaagaggacaaggctgacacggacacgagctgccgg
agcacgccgtcgctggagcggcaggagcagcggctgcgggtggagcatctgccgctgctc
accatcgagccacccagcgacagctctgtggaccttagtgaccgctcggagcgggggtca
ctcaagaggcagagtgcttacgagcgcagccttggcgggcagcagggcagtcccaagcat
ggtccccacagcggcgcccccaagagcctcccccgggaggagcctgagttgcggccccgg
ccccccaggcccctggacagccacttggccatcaatggctcagccaaccggcagagcaag
tctgagtcggactactcagacggtgacaatgacagcatcaacagcacgtccaactccaac
gataccatcaactgcagctccgagtcatcgtcccgtgacagcctgcgggagcagacgctc
agcaagcagacctaccacaaggaggcccgcaacagctgggactcgcctgcctttagcaac
gatgtcatccgcaagaggcactaccgcatcggcctgaacctcttcaacaagaagcctgag
aagggagtccagtacctcatcgagcgtggctttgtgcccgacacgcccgtcggggtggcc
cacttcctgctgcagcgcaagggcctcagccggcagatgatcggcgagttcctgggcaac
cggcagaagcagttcaaccgtgacgtgctcgactgcgtcgtggacgagatggacttctct
accatggagctggatgaggccctcaggaaattccaggcgcacatccgtgtccaaggggag
gctcagaaagtggagcggctcatagaggcgttcagccagcgctactgcatctgcaaccct
ggggtggtgcggcaattccggaacccagacaccattttcatcctggccttcgccatcatc
ctgctgaacaccgacatgtacagccccaatgtcaagcccgagcggaaaatgaagctagag
gacttcatcaagaacctccgaggtgtggacgatggtgaggacattccccgtgagatgctg
atggggatctatgaacggatccgtaagcgagagctaaagaccaatgaggaccatgtgtcc
caggtgcagaaggtggagaagctcattgtggggaaaaagccgatcggatccctgcatccc
gggctcggctgtgtgctctctctgccccaccgtcggttggtctgctactgccggctcttt
gaggttccagacccaaacaagccccagaaactcggactacaccagcgagaaatcttcctg
ttcaacgacctcctggtggtcaccaagatcttccagaagaagaagaactcggtgacgtac
agcttccgacagtccttctccttgtacggcatgcaggtcctgctcttcgagaaccagtac
taccccaatggcatccggctcacctcgtctgtccccggagcagatatcaaagtgttaata
aacttcaacgcccccaaccctcaagaccggaagaaattcaccgatgacctgcgggagtcc
attgcggaagtccaagagatggagaagcacaggatagagtcggagctcgagaagcagaaa
ggcgtcgtgcggcccagcatgtcccagtgctctagcctcaaaaaggagtcgggcaacgga
acactgagccgggcctgcctggacgacagctatgccagcggtgagggcctcaagcgcagc
gccctcagcagctccctgcgggacctctcggaagccgggaagcgagggcgtcgcagcagt
gcgggatcgctagagagcaatgtggaatttcagcctttcgagccactgcagccgtcagtg
ctgtgctcctaa

DBGET integrated database retrieval system