KEGG   Homo sapiens (human): 10586
Entry
10586             CDS       T01001                                 

Gene name
MAB21L2, MCOPS14, MCSKS14
Definition
(RefSeq) mab-21 like 2
Organism
hsa  Homo sapiens (human)
Disease
H02170  Microphthalmia, syndromic
SSDB
Motif
Pfam: Mab-21
Other DBs
NCBI-GeneID: 10586
NCBI-ProteinID: NP_006430
OMIM: 604357
HGNC: 6758
Ensembl: ENSG00000181541
Vega: OTTHUMG00000161442
Pharos: Q9Y586(Tdark)
UniProt: Q9Y586
LinkDB
Position
4q31.3
AA seq 359 aa
MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEID
ARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITAS
GYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIW
PRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGKQSSAESDAWVLQFGEAENR
LLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYECEKHPRETDWDESCLGDRL
NGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALESAAKQTWRLAREILTNPKSLDKL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgatcgccgctcaggccaagctggtttaccagctcaataagtactacactgagcgctgt
caggcgcgcaaggcggccatcgccaaaaccatccgagaggtctgtaaggtggtctcggac
gtgctcaaggaagtggaggtgcaggagcctcgcttcatcagctccttgagcgagatcgat
gcccgctacgaggggctcgaggtcatttcgcccaccgaatttgaggtggtgctctaccta
aaccagatgggcgtcttcaacttcgtggacgacggctcgctgcccggctgcgcagtgctc
aaactgagcgatgggcggaagcggagcatgtctctctgggtcgagttcatcacggcgtcg
ggctatctctcagcgcgtaagatccgctcgcgtttccagacgctggtggcccaggcggtg
gacaagtgcagctatcgggatgtggtcaagatgatcgcggacaccagcgaggtcaagttg
cgcatcagggagcgctatgtggtgcaaatcactccggcgttcaagtgcaccgggatctgg
cctcgcagcgcggcacagtggcctatgccccacatcccttggcccggccccaatcgggtg
gccgaggtcaaggccgaagggttcaacttgctctcgaaggagtgctactcgctgaccggc
aagcagagctcggcagagagcgacgcctgggtgctacagttcggggaggcggagaaccgc
ctgctgatgggcggctgccgaaacaagtgcctctcagtgctgaagactctgcgggaccgc
cacctggagctacccggccagccgctcaacaactaccacatgaagacgctgctgctgtac
gagtgcgagaaacacccacgagaaacggactgggacgagtcgtgcctgggcgaccggctc
aacggcatcctgctgcagctcatctcctgcctgcagtgccgccgctgccctcactacttt
ctgcccaacctcgacctctttcagggcaagccccattcggccctggagagcgctgccaag
cagacctggaggttggccagggaaattctcaccaatcccaaaagcctggacaaactatag

DBGET integrated database retrieval system