KEGG   Homo sapiens (human): 10587Help
Entry
10587             CDS       T01001                                 

Gene name
TXNRD2, GCCD5, SELZ, TR, TR-BETA, TR3, TRXR2
Definition
(RefSeq) thioredoxin reductase 2
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00450  Selenocompound metabolism
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
Disease
H00256  Familial glucocorticoid deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    10587 (TXNRD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10587 (TXNRD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    10587 (TXNRD2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     10587 (TXNRD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 FAD_oxidored AlaDh_PNT_C GIDA HI0933_like DAO NAD_binding_8 K_oxygenase Thi4 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 10587
NCBI-ProteinID: NP_006431
OMIM: 606448
HGNC: 18155
Ensembl: ENSG00000184470
Vega: OTTHUMG00000149975
Pharos: Q9NNW7(Tbio)
UniProt: Q9NNW7
LinkDB All DBs
Position
22q11.21
AA seq 524 aa AA seqDB search
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQ
LGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQP
VPHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS
ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDST
TGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDV
VEGRPELTPIAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHG
QEHVEVYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLVLGLHFLGPNAGEVTQGFALG
IKCGASYAQVMRTVGIHPTCSEEVVKLRISKRSGLDPTVTGCUG
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaatggcggtggcgctgcggggattaggagggcgcttccggtggcggacgcag
gccgtggcgggcggggtgcggggcgcggcgcggggcgcagcagcaggtcagcgggactat
gatctcctggtggtcggcgggggatctggtggcctggcttgtgccaaggaggccgcccag
ctgggaaggaaggtggccgtggtggactacgtggaaccttctccccaaggcacccggtgg
ggcctcggcggcacctgcgtcaacgtgggctgcatccccaagaagctgatgcaccaggcg
gcactgctgggaggcctgatccaagatgcccccaactatggctgggaggtggcccagccc
gtgccgcatgactggaggaagatggcagaagctgttcaaaatcacgtgaaatccttgaac
tggggccaccgtgtccagcttcaggacagaaaagtcaagtactttaacatcaaagccagc
tttgttgacgagcacacggtttgcggcgttgccaaaggtgggaaagagattctgctgtca
gccgatcacatcatcattgctactggagggcggccgagataccccacgcacatcgaaggt
gccttggaatatggaatcacaagtgatgacatcttctggctgaaggaatcccctggaaaa
acgttggtggtcggggccagctatgtggccctggagtgtgctggcttcctcaccgggatt
gggctggacaccaccatcatgatgcgcagcatccccctccgcggcttcgaccagcaaatg
tcctccatggtcatagagcacatggcatctcatggcacccggttcctgaggggctgtgcc
ccctcgcgggtcaggaggctccctgatggccagctgcaggtcacctgggaggacagcacc
accggcaaggaggacacgggcacctttgacaccgtcctgtgggccataggtcgagtccca
gacaccagaagtctgaatttggagaaggctggggtagatactagccccgacactcagaag
atcctggtggactcccgggaagccacctctgtgccccacatctacgccattggtgacgtg
gtggaggggcggcctgagctgacacccatagcgatcatggccgggaggctcctggtgcag
cggctcttcggcgggtcctcagatctgatggactacgacaatgttcccacgaccgtcttc
accccgctggagtatggctgtgtggggctgtccgaggaggaggcagtggctcgccacggg
caggagcatgttgaggtctatcacgcccattataaaccactggagttcacggtggctgga
cgagatgcatcccagtgttatgtaaagatggtgtgcctgagggagcccccacagctggtg
ctgggcctgcatttccttggccccaacgcaggcgaagttactcaaggatttgctctgggg
atcaagtgtggggcttcctatgcgcaggtgatgcggaccgtgggtatccatcccacatgc
tctgaggaggtagtcaagctgcgcatctccaagcgctcaggcctggaccccacggtgaca
ggctgctgagggtaa

KEGG   Homo sapiens (human): 114112Help
Entry
114112            CDS       T01001                                 

Gene name
TXNRD3, TGR, TR2, TR2IT1, TRXR3, TXNRD3IT1, TXNRD3NB, TXNRD3NT1
Definition
(RefSeq) thioredoxin reductase 3
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00450  Selenocompound metabolism
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    114112 (TXNRD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114112 (TXNRD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114112 (TXNRD3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     114112 (TXNRD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Glutaredoxin Pyr_redox_3 FAD_binding_2 AlaDh_PNT_C DAO Thi4 HI0933_like FAD_oxidored GIDA NAD_binding_7 NAD_binding_8 Peptidase_C70 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 114112
NCBI-ProteinID: NP_443115
OMIM: 606235
HGNC: 20667
Ensembl: ENSG00000197763
Vega: OTTHUMG00000162733
Pharos: Q86VQ6(Tdark)
UniProt: Q86VQ6
LinkDB All DBs
Structure
PDB: 

Position
3q21.3
AA seq 643 aa AA seqDB search
MERSPPQSPGPGKAGDAPNRRSGHVRGARVLSPPGRRARLSSPGPSRSSEAREELRRHLV
GLIERSRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTV
PNIFVNKVHVGGCDQTFQAYQSGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGK
KVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRH
NWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQ
FVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDV
TVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEG
TETIEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDIL
EDKPELTPVAIQSGKLLAQRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKK
ENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAM
KCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ctggagcggtcgccgccgcagtcgcccgggccgggaaaggcgggcgatgcccccaaccgc
cgctcgggccatgtccgaggggcgcgcgtgttgtcgccgccggggcgccgtgcccgcctg
tcgtcccccgggcccagccgctcgtccgaggcccgcgaggagctgcgccgccacctcgtg
ggcctcatcgagcgcagccgggtggtgatcttcagcaagagctactgtccccatagtact
cgggtgaaagaactcttttcttctttgggagtcgaatgtaatgtcttggaacttgatcaa
gttgatgatggggccagggttcaagaagtgctgtcagaaatcactaatcagaaaactgtg
cccaatattttcgtgaataaagtgcatgtaggtggatgtgaccaaactttccaggcatat
cagagtggtttgttacagaagctccttcaggaagatttggcatatgattatgatctcatc
atcatcggtggtggttctggaggcctttcatgtgcgaaggaagctgccattttgggaaag
aaagttatggtgctagactttgttgtcccgtcacctcagggcacatcctggggtcttggt
ggcacttgtgtaaatgtaggttgtattcctaagaaattgatgcatcaggctgcccttttg
gggcaggcattatgtgactcaaggaaatttggctgggaatataatcaacaagtgaggcac
aactgggagacaatgacaaaagcgattcagaaccacatcagctctctaaactggggctac
aggttgtctctgagggaaaaggctgtggcctatgtcaattcctatggagaatttgttgaa
catcataaaataaaggcaaccaataaaaaaggacaggagacttattatactgctgcacag
tttgtcatagcaacgggtgaaaggccacggtatttaggaatccaaggagataaagaatac
tgtattactagtgatgaccttttttctctgccttattgccctggcaaaacattagtggtg
ggtgcctcttatgttgccctggagtgtgcagggtttctggctggctttggcctagatgtc
acagttatggtacgctcaatccttctccgtggcttcgaccaagaaatggcagaaaaagtg
ggttcctacatggagcagcatggtgtgaagttcctacggaaattcatacctgtgatggtt
caacagttggagaaaggttcacctggaaagctgaaagtgttggctaaatccactgaagga
acagaaacaattgaaggagtctataacacagttttgttagctattggtcgtgactcctgt
acaaggaaaataggcttggagaagattggtgtcaaaattaatgagaagagtggaaaaata
cctgtaaatgatgtggaacagaccaatgtgccatatgtctatgctgttggtgatattttg
gaggataagccagagctcactcctgtcgccatacagtcaggcaagctgctagctcagaga
ctttttggggcctctttagaaaagtgtgattatattaatgttccgactacagtgtttact
cctctggagtatggttgctgtggattatctgaagagaaagctattgaagtatataaaaaa
gagaatctagaaatatatcatactttgttctggcctcttgaatggacagtagctggcaga
gagaacaacacttgttatgcaaagataatctgcaataaattcgaccatgatcgggtgata
ggatttcatattcttggaccaaacgccggtgaggttacccaaggatttgcagctgcaatg
aaatgtgggctcacaaaacagctacttgatgacaccattggaattcaccccacatgtggg
gaggtgttcacgactttggaaatcacaaagtcgtcaggactagacatcactcagaaaggc
tgctgaggctag

KEGG   Homo sapiens (human): 7296Help
Entry
7296              CDS       T01001                                 

Gene name
TXNRD1, GRIM-12, TR, TR1, TRXR1, TXNR
Definition
(RefSeq) thioredoxin reductase 1
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00450  Selenocompound metabolism
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    7296 (TXNRD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7296 (TXNRD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7296 (TXNRD1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     7296 (TXNRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 Glutaredoxin FAD_oxidored AlaDh_PNT_C HI0933_like Thi4 DAO GIDA NAD_binding_8 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 7296
NCBI-ProteinID: NP_001087240
OMIM: 601112
HGNC: 12437
Ensembl: ENSG00000198431
Vega: OTTHUMG00000166481
Pharos: Q16881(Tclin)
UniProt: Q16881
LinkDB All DBs
Structure
PDB: 

Position
12q23.3
AA seq 649 aa AA seqDB search
MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL
PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKE
AAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
EETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEK
IYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIY
AIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKA
VEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQ
GFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgccgagggcaaggcagtggcggcggccgccccaacggagctgcagacgaaa
ggcaagaacggcgatggccgccgtaggtcagctaaagatcatcaccctggtaaaactttg
ccagagaacccagcaggattcaccagcacggccactgcagactccagagccctgcttcag
gcctatatagatggtcactctgtggtcatcttcagtaggtccacatgcacacgctgtact
gaggtaaagaagttatttaaatctctgtgtgttccttattttgtgcttgaacttgatcaa
acagaggacggtcgggccctggaaggaacgctctcggaattggccgcggaaaccgatctg
cccgttgtgtttgtgaaacagagaaagataggcggccatggtccaaccttgaaggcttat
caggagggcagacttcaaaagctactaaaaatgaacggccctgaagatcttcccaagtcc
tatgactatgaccttatcatcattggaggtggctcaggaggtctggcagctgctaaggag
gcagcccaatatggcaagaaggtgatggtcctggactttgtcactcccacccctcttgga
actagatggggtctcggaggaacatgtgtgaatgtgggttgcatacctaaaaaactgatg
catcaagcagctttgttaggacaagccctgcaagactctcgaaattatggatggaaagtc
gaggagacagttaagcatgattgggacagaatgatagaagctgtacagaatcacattggc
tctttgaattggggctaccgagtagctctgcgggagaaaaaagtcgtctatgagaatgct
tatgggcaatttattggtcctcacaggattaaggcaacaaataataaaggcaaagaaaaa
atttattcagcagagagatttctcattgccactggtgaaagaccacgttacttgggcatc
cctggtgacaaagaatactgcatcagcagtgatgatcttttctccttgccttactgcccg
ggtaagaccctggttgttggagcatcctatgtcgctttggagtgcgctggatttcttgct
ggtattggtttagacgtcactgttatggttaggtccattcttcttagaggatttgaccag
gacatggccaacaaaattggtgaacacatggaagaacatggcatcaagtttataagacag
ttcgtaccaattaaagttgaacaaattgaagcagggacaccaggccgactcagagtagta
gctcagtccaccaatagtgaggaaatcattgaaggagaatataatacggtgatgctggca
ataggaagagatgcttgcacaagaaaaattggcttagaaaccgtaggggtgaagataaat
gaaaagactggaaaaatacctgtcacagatgaagaacagaccaatgtgccttacatctat
gccattggcgatatattggaggataaggtggagctcaccccagttgcaatccaggcagga
agattgctggctcagaggctctatgcaggttccactgtcaagtgtgactatgaaaatgtt
ccaaccactgtatttactcctttggaatatggtgcttgtggcctttctgaggagaaagct
gtggagaagtttggggaagaaaatattgaggtttaccatagttacttttggccattggaa
tggacgattccgtcaagagataacaacaaatgttatgcaaaaataatctgtaatactaaa
gacaatgaacgtgttgtgggctttcacgtactgggtccaaatgctggagaagttacacaa
ggctttgcagctgcgctcaaatgtggactgaccaaaaagcagctggacagcacaattgga
atccaccctgtctgtgcagaggtattcacaacattgtctgtgaccaagcgctctggggca
agcatcctccaggctggctgctgaggttaa

DBGET integrated database retrieval system