KEGG   Homo sapiens (human): 10603
Entry
10603             CDS       T01001                                 

Gene name
SH2B2, APS
Definition
(RefSeq) SH2B adaptor protein 2
  KO
K07193  SH2B adapter protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    10603 (SH2B2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    10603 (SH2B2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    10603 (SH2B2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   10603 (SH2B2)
SSDB
Motif
Pfam: Phe_ZIP SH2 PH
Other DBs
NCBI-GeneID: 10603
NCBI-ProteinID: NP_066189
OMIM: 605300
HGNC: 17381
Ensembl: ENSG00000160999
Vega: OTTHUMG00000150652
Pharos: O14492(Tbio)
UniProt: O14492
LinkDB
Structure
PDB: 
1Q2H

Position
7q22.1
AA seq 675 aa
MDPSYCPAHGFPSQDPLWPLSSQQWSSAHYSEPAAGGCDGTEAMNGAGPGPAAAAPVPVP
VPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDAGASFSRHFAANFLDVFGEEV
RRVLVAGPTTRGAAVSAEAMEPELADTSALKAAPYGHSRSSEDVSTHAATKARVRKGFSL
RNMSLCVVDGVRDMWHRRASPEPDAAAAPRTAEPRDKWTRRLRLSRTLAAKVELVDIQRE
GALRFMVADDAAAGSGGSAQWQKCRLLLRRAVAEERFRLEFFVPPKASRPKVSIPLSAII
EVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTELS
CTRGGCLASRVASCSCELLTDAVDLPRPPETTAVGAVVTAPHSRGRDAVRESLIHVPLET
FLQTLESPGGSGSDSNNTGEQGAETDPEAEPELELSDYPWFHGTLSRVKAAQLVLAGGPR
NHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDMLRHFHTH
PIPLESGGSADITLRSYVRAQDPPPEPGPTPPAAPASPACWSDSPGQHYFSSLAAAACPP
ASPSDAAGASSSSASSSSAASGPAPPRPVEGQLSARSRSNSAERLLEAVAATAAEEPPEA
APGRARAVENQYSFY
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggatccaagctattgtcctgcccatggcttcccatctcaggaccctctctggccgcta
tcatcccagcagtggagttcagcccactactctgaaccagccgcaggtggctgcgatggg
acggaagccatgaatggtgccggccctggccccgccgcagccgccccggtcccagtcccg
gtcccggtcccggactggcggcagttctgcgagctgcatgcgcaggcggccgccgtggac
tttgcgcacaagttctgccgtttcctgcgggacaacccagcttacgacacgcccgacgcc
ggcgcctccttctcccgccacttcgccgccaacttcctggacgtcttcggcgaggaggtg
cgccgcgtgctggtggctgggccgacgactcggggcgcggccgtgagcgcagaggccatg
gagccggagctcgcggacacctctgcactcaaggcggcgccctacggccactcgcggagc
tcggaggacgtgtccacgcacgcggccaccaaggcccgcgttcgcaagggcttctcgctg
cgcaacatgagcctgtgcgtggtggacggcgtgcgcgacatgtggcaccggcgcgcctcg
cccgagcccgacgcggcagctgccccgcgcaccgccgagccccgcgacaagtggacgcgg
cgcctgaggctgtcgcggacgctggctgccaaggtggagctggtggacattcaacgcgag
ggggcgctgcgcttcatggtggccgacgacgcggccgcgggctccgggggctcggctcag
tggcagaagtgccgcctgctcctgcgcagggctgtggccgaggaacgcttccgcctggag
ttcttcgtgccgcccaaagcctccaggcccaaggtcagcatcccactgtcagccatcatt
gaggtccgcaccaccatgcccctggaaatgccagagaaggataacacattcgtcctcaag
gtagagaatggagccgaatacatcttggagaccatcgactctctgcagaagcactcgtgg
gtagctgacatccagggctgcgtggaccccggtgacagtgaggaagacaccgagctctcc
tgtacccgaggaggctgtctggccagccgcgtggcctcctgcagctgtgagctcctgact
gatgcagtcgacctgccccgccccccagagacgacagccgtgggtgcagtggtgacagcc
ccccacagccgaggtcgagatgccgtcagagaatccctgatccacgtcccgctagagacc
tttctgcagaccctggaatccccgggcggcagcggcagtgacagcaataacacaggggaa
cagggtgcagagacggatcccgaggctgaacccgagctggagctatccgactacccatgg
ttccacgggacactgtcccgggtcaaggctgctcaactggttctggcaggggggccccgg
aaccacggcctcttcgtgatccgccaaagtgagactcggcctggggagtacgtgctgacc
ttcaacttccagggcaaggccaagcacctgcgcctgtccctgaacggccacggccagtgt
cacgtacagcatctgtggttccagtctgtgcttgacatgctccgccacttccacacacac
cccatcccactggagtcagggggctcggccgacatcacccttcgcagctatgtgcgggcc
caggaccccccaccagagccgggccccacgccccctgccgcgcccgcgtccccggcctgc
tggagcgactcgcccggccagcactacttctccagcctcgccgcggccgcctgcccgcct
gcctcgccctccgacgccgccggcgcctcctcgtcttccgcctcgtcgtcctctgccgcg
tcggggcccgcccccccgcgccccgtcgagggccagctcagcgcgcggagccgcagcaac
agcgccgagcgcctgctggaggccgtggccgccaccgccgccgaggagcccccggaggcc
gcgcccggccgcgcgcgcgccgtggagaaccagtactccttctactag

DBGET integrated database retrieval system