KEGG   Homo sapiens (human): 10610
Entry
10610             CDS       T01001                                 

Gene name
ST6GALNAC2, SAITL1, SIAT7, SIAT7B, SIATL1, ST6GalNAII, STHM
Definition
(RefSeq) ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 2
  KO
K06616  alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7B) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    10610 (ST6GALNAC2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     10610 (ST6GALNAC2)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   10610 (ST6GALNAC2)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 10610
NCBI-ProteinID: NP_006447
OMIM: 610137
HGNC: 10867
Ensembl: ENSG00000070731
Vega: OTTHUMG00000191877
Pharos: Q9UJ37(Tbio)
UniProt: Q9UJ37 A0A024R8M1
LinkDB
Structure
PDB: 
6APL 6APJ

Position
17q25.1
AA seq 374 aa
MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAFFQSKASNSWT
GKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQ
VIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNG
AVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVML
RSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDL
YMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALW
RDLHKAGILQLYQR
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggggctcccgcgcgggtcgttcttctggctgctgctcctgctcacggctgcctgctcg
gggctcctctttgccctgtacttctcggcggtgcagcggtacccggggccagcggccgga
gccagggacaccacatcatttgaagcattctttcaatccaaggcatcgaattcttggaca
ggaaagggccaggcctgccgacacctgcttcacctggccattcagcggcacccccacttc
cgtggcctgttcaatctctccattccagtgctgctgtggggggacctcttcaccccagcg
ctctgggaccgcctgagccaacacaaagccccgtatggctggcgggggctctctcaccaa
gtcatcgcctccaccctgagccttctgaacggctcagagagtgccaagctgtttgccccg
cccagggacacccctccaaagtgtatccggtgtgccgtggtgggcaacggaggcattctg
aatgggtcccgccagggtcccaacatcgatgcccatgactatgtattcagactcaatgga
gctgtgatcaaaggcttcgagcgcgatgtgggcaccaagacttccttctatggtttcact
gtgaacacgatgaagaactccctcgtctcctactggaatctgggcttcacctccgtgcca
caaggacaggacctgcagtatatcttcatcccctcagacatccgcgactatgtgatgctg
agatcggccattctgggcgtgcctgtccctgagggcctagataaaggggacaggccgcac
gcctattttggaccagaagcctctgccagtaaattcaagctgctacatccggacttcatc
agctacctgacagaaaggttcttgaaatcaaagttgattaacacacattttggagaccta
tatatgcctagtaccggggctctcatgctgctgacagctttgcatacctgtgaccaggtc
agtgcctatggattcatcacaagcaactactggaaattttccgaccactatttcgaacga
aaaatgaagccattgatattttatgcaaaccacgatctgtccctggaagctgccctgtgg
agggacctgcacaaggccggcatccttcagctgtaccagcgctga

DBGET integrated database retrieval system