KEGG   Homo sapiens (human): 10616Help
Entry
10616             CDS       T01001                                 

Gene name
RBCK1, C20orf18, HOIL-1, HOIL1, PBMEI, PGBM1, RBCK2, RNF54, UBCE7IP3, XAP3, XAP4, ZRANB4
Definition
(RefSeq) RANBP2-type and C3HC4-type zinc finger containing 1
  KO
K10630  RanBP-type and C3HC4-type zinc finger-containing protein 1 [EC:2.3.2.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
Disease
H01744  Autoinflammatory syndrome with pyogenic bacterial infection and amylopectinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    10616 (RBCK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    10616 (RBCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10616 (RBCK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10616 (RBCK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     10616 (RBCK1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    10616 (RBCK1)
  Multi subunit Ring-finger type E3
   LUBAC complex
    10616 (RBCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_UBOX IBR zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-RanBP zf-C3HC4_4 zf-RING_11 ubiquitin
Motif
Other DBs
NCBI-GeneID: 10616
NCBI-ProteinID: NP_112506
OMIM: 610924
HGNC: 15864
Ensembl: ENSG00000125826
Vega: OTTHUMG00000031634
Pharos: Q9BYM8(Tbio)
UniProt: Q9BYM8
LinkDB All DBs
Structure
PDB: 

Position
20p13
AA seq 510 aa AA seqDB search
MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVS
VEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVR
QNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQE
PGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARL
AGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLREC
LHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISI
AENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLAL
RAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPR
WGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaagaccaagaaagcagaggaaatggccctgagcctcacccgagcagtggcg
ggcggggatgaacaggtggcaatgaagtgtgccatctggctggcagagcaacgggtgccc
ctgagtgtgcaactgaagcctgaggtctccccaacgcaggacatcaggctgtgggtgagc
gtggaggatgctcagatgcacaccgtcaccatctggctcacagtgcgccctgatatgaca
gtggcgtctctcaaggacatggtttttctggactatggcttcccaccagtcttgcagcag
tgggtgattgggcagcggctggcacgagaccaggagaccctgcactcccatggggtgcgg
cagaatggggacagtgcctacctctatctgctgtcagcccgcaacacctccctcaaccct
caggagctgcagcgggagcggcagctgcggatgctggaagatctgggcttcaaggacctc
acgctgcagccgcggggccctctggagccaggccccccaaagcccggggtcccccaggaa
cccggacgggggcagccagatgcagtgcctgagcccccaccggtgggctggcagtgcccc
gggtgcaccttcatcaacaagcccacgcggcctggctgtgagatgtgctgccgggcgcgc
cccgaggcctaccaggtccccgcctcataccagcccgacgaggaggagcgagcgcgcctg
gcgggcgaggaggaggcgctgcgtcagtaccagcagcggaagcagcagcagcaggagggg
aactacctgcagcacgtccagctggaccagaggagcctggtgctgaacacggagcccgcc
gagtgccccgtgtgctactcggtgctggcgcccggcgaggccgtggtgctgcgtgagtgt
ctgcacaccttctgcagggagtgcctgcagggcaccatccgcaacagccaggaggcggag
gtctcctgccccttcattgacaacacctactcgtgctcgggcaagctgctggagagggag
atcaaggcgctcctgacccctgaggattaccagcgatttctagacctgggcatctccatt
gctgaaaaccgcagtgccttcagctaccattgcaagaccccagattgcaagggatggtgc
ttctttgaggatgatgtcaatgagttcacctgccctgtgtgtttccacgtcaactgcctg
ctctgcaaggccatccatgagcagatgaactgcaaggagtatcaggaggacctggccctg
cgggctcagaacgatgtggctgcccggcagacgacagagatgctgaaggtgatgctgcag
cagggcgaggccatgcgctgcccccagtgccagatcgtggtacagaagaaggacggctgc
gactggatccgctgcaccgtctgccacaccgagatctgctgggtcaccaagggcccacgc
tggggccctgggggcccaggagacaccagcgggggctgccgctgcagggtaaatgggatt
ccttgccacccaagctgtcagaactgccactga

KEGG   Homo sapiens (human): 55072Help
Entry
55072             CDS       T01001                                 

Gene name
RNF31, HOIP, Paul, ZIBRA
Definition
(RefSeq) ring finger protein 31
  KO
K11974  E3 ubiquitin-protein ligase RNF31 [EC:2.3.2.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N00945  Shigella IpaH1.4/2.5 to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    55072 (RNF31)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    55072 (RNF31)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55072 (RNF31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55072 (RNF31)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     55072 (RNF31)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    55072 (RNF31)
  Multi subunit Ring-finger type E3
   LUBAC complex
    55072 (RNF31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HOIP-UBA PUB_1 E3_UbLigase_RBR PUB IBR zf-RanBP
Motif
Other DBs
NCBI-GeneID: 55072
NCBI-ProteinID: NP_060469
OMIM: 612487
HGNC: 16031
Ensembl: ENSG00000092098
Vega: OTTHUMG00000028798
Pharos: Q96EP0(Tbio)
UniProt: Q96EP0
LinkDB All DBs
Structure
PDB: 

Position
14q12
AA seq 1072 aa AA seqDB search
MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCN
AHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLED
KVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPGTLHCPSCKQALCPAC
DHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASA
HLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLARGRWACQSCT
FENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTF
CNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQR
QDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAG
QQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQ
HGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAE
LALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECT
ICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYAL
FHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRS
CEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSG
CYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAG
ARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATL
YEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgccgggggaggaagaggagcgggccttcctggtggcccgcgaggagctggcgagcgcc
ctgaggagggattccgggcaggcgttttccctggagcagctccggccgctactagccagc
tctctgccgctagccgcccgctacctgcagctggacgccgcacgccttgtccgctgcaac
gctcatggggagccccgaaactacctcaacaccctgtccacggctctgaacatcctggag
aaatacggccgcaaccttctcagccctcagcggcctcggtactggcgtggtgtcaagttt
aataaccctgtctttcgcagcacggtggatgctgtgcaggggggccgagatgtgctgcga
ttatatggctacacagaggagcaaccagatgggttgagcttccccgaagggcaggaggag
ccagatgagcaccaggttgctacagtcacactggaagtactgctgcttcggacagagctc
agcctgctattgcagaatactcatccaagacagcaggcactggagcagctgttggaagac
aaggttgaagatgatatgctgcagctttcagaatttgaccccctattgagagagattgct
cctggccccctcaccacaccctctgtcccaggctccactcctggtccctgcttcctctgt
ggttctgccccaggcacactgcactgcccatcctgtaaacaggccctgtgtccagcctgt
gaccacctgttccatggacacccatcccgtgctcatcacctccgccagaccctgcctggg
gtcctgcagggtacccacctgagccccagtttacctgcctcagcccaaccacggccccag
tcgacctccctgctggccctgggagacagctctctttcttcccctaatcctgcaagtgct
catttgccctggcactgtgctgcctgtgccatgctaaatgagccttgggcagtgctctgt
gtggcctgtgatcggccccgaggctgtaaggggttggggttgggaactgagggtccccaa
ggaactggaggcctagaacctgatcttgcacggggtcggtgggcctgccagagctgtacc
tttgagaatgaggcagctgctgtgctatgttccatatgtgagcgacctcggctggcccag
cctcccagcttggtggtggattcccgagatgctggcatttgcctgcaaccccttcagcag
ggggatgctttgctggcctctgcccagagtcaagtctggtactgtattcactgtaccttc
tgcaactcgagccctggctgggtgtgtgttatgtgcaaccggactagtagccccattcca
gcacaacatgccccccggccctatgccagctctttggaaaagggaccccccaagcctggg
cccccacgacgccttagtgcccccctgcccagttcctgtggagatcctgagaagcagcgc
caagacaagatgcgggaagaaggcctccagctagtgagcatgatccgggaaggggaagcc
gcaggtgcctgtccagaggagatcttctcggctctgcagtactcgggcactgaggtgcct
ctgcagtggttgcgctcagaactgccctacgtcctggagatggtggctgagctggctgga
cagcaggaccctgggctgggtgccttttcctgtcaggaggcccggagagcctggctggat
cgtcatggcaaccttgatgaagctgtggaggagtgtgtgaggaccaggcgaaggaaggtg
caggagctccagtctctaggctttgggcctgaggaggggtctctccaggcattgttccag
cacggaggtgatgtgtcacgggccctgactgagctacagcgccaacgcctagagcccttc
cgccagcgcctctgggacagtggccctgagcccaccccttcctgggatgggccagacaag
cagagcctggtcaggcggcttttggcagtctacgcactccccagctggggccgggcagag
ctggcactgtcactgctgcaggagacacccaggaactatgagttgggggatgtggtagaa
gctgtgaggcacagccaggaccgggccttcctgcgccgcttgcttgcccaggagtgtgcc
gtgtgtggctgggccctgccccacaaccggatgcaggccctgacttcctgtgagtgcacc
atctgtcctgactgcttccgccagcacttcaccatcgccttgaaggagaagcacatcaca
gacatggtgtgccctgcctgtggccgccccgacctcaccgatgacacacagttgctcagc
tacttctctacccttgacatccagcttcgcgagagcctagagccagatgcctatgcgttg
ttccataagaagctgaccgagggtgtgctgatgcgggaccccaagttcttgtggtgtgcc
cagtgctcctttggcttcatatatgagcgtgagcagctggaggcaacttgtccccagtgt
caccagaccttctgtgtgcgctgcaagcgccagtgggaggagcagcaccgaggtcggagc
tgtgaggacttccagaactggaaacgcatgaacgacccagaataccaggcccagggccta
gcaatgtatcttcaggaaaacggcattgactgccccaaatgcaagttctcgtacgccctg
gcccgaggaggctgcatgcactttcactgtacccagtgccgccaccagttctgcagcggc
tgctacaatgccttttacgccaagaataaatgtccagagcctaactgcagggtgaaaaag
tccctgcacggccaccaccctcgagactgcctcttctacctgcgggactggactgctctc
cggcttcagaagctgctacaggacaataacgtcatgtttaatacagagcctccagctggg
gcccgggcagtccctggaggcggctgccgagtgatagagcagaaggaggttcccaatggg
ctcagggacgaagcttgtggcaaggaaactccagctggctatgccggcctgtgccaggca
cactacaaagagtatcttgtgagcctcatcaatgcccactcgctggacccagccaccttg
tatgaggtggaagagctggagacggccactgagcgctacctgcacgtacgcccccagcct
ttggctggagaggatccccctgcttaccaggcccgcttgttacagaagctgacagaagag
gtacccttgggacagagtatcccccgcaggcggaagtag

KEGG   Homo sapiens (human): 81858Help
Entry
81858             CDS       T01001                                 

Gene name
SHARPIN, SIPL1
Definition
(RefSeq) SHANK associated RH domain interactor
  KO
K20894  shank-associated RH domain-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    81858 (SHARPIN)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    81858 (SHARPIN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    81858 (SHARPIN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    81858 (SHARPIN)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   LUBAC complex
    81858 (SHARPIN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sharpin_PH zf-RanBP ubiquitin
Motif
Other DBs
NCBI-GeneID: 81858
NCBI-ProteinID: NP_112236
OMIM: 611885
HGNC: 25321
Ensembl: ENSG00000179526
Vega: OTTHUMG00000165243
Pharos: Q9H0F6(Tbio)
UniProt: Q9H0F6 Q6PJD5
LinkDB All DBs
Structure
PDB: 

Position
8q24.3
AA seq 387 aa AA seqDB search
MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLEL
LGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGAT
VEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLA
RAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHV
ALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLL
SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFI
NAPDRPGCEMCSTQRPCTWDPLAAAST
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgccagcgggcggggcggcggcggcggcctcggacttgggctccgccgcagtg
ctcttggctgtgcacgccgcggtgaggccgctgggcgccgggccagacgccgaggcacag
ctgcggaggctgcagctgagcgcggaccctgagcggcctgggcgcttccggctggagctg
ctgggcgcgggacctggggcggttaatttggagtggcccctggagtcagtttcctacacc
atccgaggccccacccagcacgagctacagcctccaccaggagggcctggaaccctcagc
ctgcacttcctcaaccctcaggaagctcagcggtgggcagtcctagtccgaggtgccacc
gtggaaggacagaatggcagcaagagcaactcaccaccagccttgggcccagaagcatgc
cctgtctccctgcccagtcccccggaagcctccacactcaagggccctccacctgaggca
gatcttcctaggagccctggaaacttgacggagagagaagagctggcagggagcctggcc
cgggctattgcaggtggagacgagaagggggcagcccaagtggcagccgtcctggcccag
catcgtgtggccctgagtgttcagcttcaggaggcctgcttcccacctggccccatcagg
ctgcaggtcacacttgaagacgctgcctctgccgcatccgccgcgtcctctgcacacgtt
gccctgcaggtccacccccactgcactgttgcagctctccaggagcaggtgttctcagag
ctcggtttcccgccagccgtgcaacgctgggtcatcggacggtgcctgtgtgtgcctgag
cgcagccttgcctcttacggggttcggcaggatggggaccctgctttcctctacttgctg
tcagctcctcgagaagccccagccacaggacctagccctcagcacccccagaagatggac
ggggaacttggacgcttgtttcccccatcattggggctacccccaggcccccagccagct
gcctccagcctgcccagtccactccagcccagctggtcctgtccttcctgcaccttcatc
aatgccccagaccgccctggctgtgagatgtgtagcacccagaggccctgcacttgggac
ccccttgctgcagcttccacctag

DBGET integrated database retrieval system