KEGG   Homo sapiens (human): 10617Help
Entry
10617             CDS       T01001                                 

Gene name
STAMBP, AMSH, MICCAP
Definition
(RefSeq) STAM binding protein
  KO
K11866  STAM-binding protein [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H01872  Microcephaly-capillary malformation syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10617 (STAMBP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    10617 (STAMBP)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10617 (STAMBP)
   04121 Ubiquitin system [BR:hsa04121]
    10617 (STAMBP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     10617 (STAMBP)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M67
   10617 (STAMBP)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   Others
    10617 (STAMBP)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    10617 (STAMBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP8_dimer JAB Prok-JAB TPR_8
Motif
Other DBs
NCBI-GeneID: 10617
NCBI-ProteinID: NP_006454
OMIM: 606247
HGNC: 16950
Ensembl: ENSG00000124356
Vega: OTTHUMG00000129817
Pharos: O95630(Tbio)
UniProt: O95630 A0A140VK54
LinkDB All DBs
Structure
PDB: 

Position
2p13.1
AA seq 424 aa AA seqDB search
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAF
ILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTE
YNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLK
IVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPG
ALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVL
IPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLP
ESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI
TDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccatggagatgtgagcctcccgcccgaagaccgggtgagggctctctcccag
ctgggtagtgcggtagaggtgaatgaagacattccaccccgtcggtacttccgctctgga
gttgagattatccgaatggcatccatttactctgaggaaggcaacattgaacatgccttc
atcctctataacaagtatatcacgctctttattgagaaactaccaaaacatcgagattac
aaatctgctgtcattcctgaaaagaaagacacagtaaagaaattaaaggagattgcattt
cccaaagcagaagagctgaaggcagagctgttaaaacgatataccaaagaatatacagaa
tataatgaagaaaagaagaaggaagcagaggaattggcccggaacatggccatccagcaa
gagctggaaaaggaaaaacagagggtagcacaacagaagcagcagcaattggaacaggaa
cagttccatgccttcgaggagatgatccggaaccaggagctagaaaaagagcgactgaaa
attgtacaggagtttgggaaggtagaccctggcctaggtggcccgctagtgcctgacttg
gagaagccctccttagatgtgttccccaccttaacagtctcatccatacagccttcagac
tgtcacacaactgtaaggccagctaagccacctgtggtggacaggtccttgaaacctgga
gcactgagcaactcagaaagtattcccacaatcgatggattgcgccatgtggtggtgcct
gggcggctgtgcccacagtttctccagttagccagtgccaacactgcccggggagtggag
acatgtggaattctctgtggaaaactgatgaggaatgaatttaccattacccatgttctc
atccccaagcaaagtgctgggtctgattactgcaacacagagaacgaagaagaacttttc
ctcatacaggatcagcagggcctcatcacactgggctggattcatactcaccccacacag
accgcgtttctctccagtgtcgacctacacactcactgctcttaccagatgatgttgcca
gagtcagtagccattgtttgctcccccaagttccaggaaactggattctttaaactaact
gaccatggactagaggagatttcttcctgtcgccagaaaggatttcatccacacagcaag
gatccacctctgttctgtagctgcagccacgtgactgttgtggacagagcagtgaccatc
acagaccttcgatga

DBGET integrated database retrieval system