KEGG   Homo sapiens (human): 10636Help
Entry
10636             CDS       T01001                                 

Gene name
RGS14
Definition
(RefSeq) regulator of G protein signaling 14
  KO
K17706  regulator of G-protein signaling 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    10636 (RGS14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RBD RGS GoLoco RGS12_us1
Motif
Other DBs
NCBI-GeneID: 10636
NCBI-ProteinID: NP_006471
OMIM: 602513
HGNC: 9996
Ensembl: ENSG00000169220
Vega: OTTHUMG00000163324
Pharos: O43566(Tbio)
UniProt: O43566
LinkDB All DBs
Structure
PDB: 

Position
5q35.3
AA seq 566 aa AA seqDB search
MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARN
IYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
RECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQLPPVEGPGGRPL
RKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRP
GKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCT
VLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPG
EKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPS
SLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSS
EETPPQTKSAAQPIGGSLNSTTDSAL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgccagggaagcccaagcacctgggcgtccccaacgggcgcatggttctggctgtgtca
gatggagagctgagcagcacgacggggccccagggccagggcgagggccgcggcagctct
ctcagcatccacagcctccccagtggtcccagcagccccttcccaaccgaggagcagcct
gtggccagctgggccctgtccttcgagcggctgttgcaggacccgctgggcctggcttac
ttcactgagttcctgaagaaggagttcagcgcggaaaacgtgactttctggaaggcctgc
gagcgcttccagcagatcccggccagcgatacccagcagctagctcaggaggcccgcaac
atctaccaggagttcctgtccagccaggcgctgagcccagtgaacatcgaccgtcaggcc
tggcttggcgaggaggtgctggccgagccccggccggacatgtttcgggcacagcagctt
cagatcttcaacttgatgaagttcgacagctatgcgcgcttcgtcaagtccccgctgtac
cgcgagtgcctgctagccgaagccgagggacgccctctgcgggaacctggctcctcgcgc
ctcggcagccctgacgccacgaggaagaagccgaagctgaagcccgggaagtcgctgccg
ctgggtgtggaggagttggggcagctgccacccgttgagggtcctgggggccgccctctc
cgcaagtccttccgccgggagctgggcgggactgcaaacgccgccttgcgccgagagtct
cagggctccctcaactcctccgccagcctggaccttggcttcctagccttcgtcagcagc
aaatctgagagccaccggaagagccttgggagcacggagggtgaaagtgaaagccggcca
gggaagtactgctgtgtgtacctgcccgatggcacagcctccttggccctggccagacct
ggcctcaccatccgagacatgctggcagggatctgtgagaaacgaggcctctctctacct
gacatcaaggtctacctggtgggcaatgaacaggccctggtcctggatcaggactgcacc
gtgctggcggatcaggaagtgcggctggaaaacaggatcaccttcgagctggagctgacg
gcgctggagcgcgtggtacgaatctcagccaagcccaccaagcggctgcaggaggcgctg
cagcccattctggagaagcacggcttgagcccgctagaggtggtgctgcaccggccaggc
gagaaacagcctctggatctggggaagctagtgagctcggtggcggcccagagactggtt
ttggacactcttccaggtgtgaagatctccaaagcccgtgacaaatctccctgccgcagc
cagggctgcccacctagaactcaggataaggccacccatccccctccagcgtcccccagt
tctctggtgaaggtgcccagtagtgccactggaaagcggcagacctgtgacatcgaaggc
ctggtggagctgctgaaccgggtgcagagcagcggggcccacgaccagaggggccttctg
aggaaagaggacctggtacttccagaatttctgcagctgcccgcccaagggcccagctcc
gaggagaccccaccacagaccaaatcagcagcccagcccatcgggggatccttgaactcc
accaccgactcagccctctga

DBGET integrated database retrieval system