KEGG   Homo sapiens (human): 10644
Entry
10644             CDS       T01001                                 

Gene name
IGF2BP2, IMP-2, IMP2, VICKZ2
Definition
(RefSeq) insulin like growth factor 2 mRNA binding protein 2
  KO
K17392  insulin-like growth factor 2 mRNA-binding protein 2
Organism
hsa  Homo sapiens (human)
Disease
H00409  Type 2 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    10644 (IGF2BP2)
SSDB
Motif
Pfam: KH_1 RRM_1 KH_2 KH_4 MOEP19 KH_5 RRM_5
Other DBs
NCBI-GeneID: 10644
NCBI-ProteinID: NP_006539
OMIM: 608289
HGNC: 28867
Ensembl: ENSG00000073792
Vega: OTTHUMG00000074025
Pharos: Q9Y6M1(Tbio)
UniProt: Q9Y6M1
LinkDB
Structure
PDB: 
6ROL 2CQH

Position
3q27.2
AA seq 599 aa
MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSG
KVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTET
AVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQG
HAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEK
PVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKI
EHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQA
NLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPH
HHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITG
PPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTS
AEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgatgaacaagctttacatcgggaacctgagccccgccgtcaccgccgacgacctccgg
cagctctttggggacaggaagctgcccctggcgggacaggtcctgctgaagtccggctac
gccttcgtggactaccccgaccagaactgggccatccgcgccatcgagaccctctcgggt
aaagtggaattgcatgggaaaatcatggaagttgattactcagtctctaaaaagctaagg
agcaggaaaattcagattcgaaacatccctcctcacctgcagtgggaggtgttggatgga
cttttggctcaatatgggacagtggagaatgtggaacaagtcaacacagacacagaaacc
gccgttgtcaacgtcacatatgcaacaagagaagaagcaaaaatagccatggagaagcta
agcgggcatcagtttgagaactactccttcaagatttcctacatcccggatgaagaggtg
agctccccttcgccccctcagcgagcccagcgtggggaccactcttcccgggagcaaggc
cacgcccctgggggcacttctcaggccagacagattgatttcccgctgcggatcctggtc
cccacccagtttgttggtgccatcatcggaaaggagggcttgaccataaagaacatcact
aagcagacccagtcccgggtagatatccatagaaaagagaactctggagctgcagagaag
cctgtcaccatccatgccaccccagaggggacttctgaagcatgccgcatgattcttgaa
atcatgcagaaagaggcagatgagaccaaactagccgaagagattcctctgaaaatcttg
gcacacaatggcttggttggaagactgattggaaaagaaggcagaaatttgaagaaaatt
gaacatgaaacagggaccaagataacaatctcatctttgcaggatttgagcatatacaac
ccggaaagaaccatcactgtgaagggcacagttgaggcctgtgccagtgctgagatagag
attatgaagaagctgcgtgaggcctttgaaaatgatatgctggctgttaaccaacaagcc
aatctgatcccagggttgaacctcagcgcacttggcatcttttcaacaggactgtccgtg
ctatctccaccagcagggccccgcggagctccccccgctgccccctaccaccccttcact
acccactccggatacttctccagcctgtacccccatcaccagtttggcccgttcccgcat
catcactcttatccagagcaggagattgtgaatctcttcatcccaacccaggctgtgggc
gccatcatcgggaagaagggggcacacatcaaacagctggcgagattcgccggagcctct
atcaagattgcccctgcggaaggcccagacgtcagcgaaaggatggtcatcatcaccggg
ccaccggaagcccagttcaaggcccagggacggatctttgggaaactgaaagaggaaaac
ttctttaaccccaaagaagaagtgaagctggaagcgcatatcagagtgccctcttccaca
gctggccgggtgattggcaaaggtggcaagaccgtgaacgaactgcagaacttaaccagt
gcagaagtcatcgtgcctcgtgaccaaacgccagatgaaaatgaggaagtgatcgtcaga
attatcgggcacttctttgctagccagactgcacagcgcaagatcagggaaattgtacaa
caggtgaagcagcaggagcagaaataccctcagggagtcgcctcacagcgcagcaagtga

DBGET integrated database retrieval system