KEGG   Homo sapiens (human): 10654Help
Entry
10654             CDS       T01001                                 

Gene name
PMVK, HUMPMKI, PMK, PMKA, PMKASE, POROK1
Definition
(RefSeq) phosphomevalonate kinase
  KO
K13273  phosphomevalonate kinase [EC:2.7.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Module
hsa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Disease
H01933  Porokeratosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    10654 (PMVK)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    10654 (PMVK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.2  phosphomevalonate kinase
     10654 (PMVK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P-mevalo_kinase
Motif
Other DBs
NCBI-GeneID: 10654
NCBI-ProteinID: NP_006547
OMIM: 607622
HGNC: 9141
Ensembl: ENSG00000163344
Vega: OTTHUMG00000037415
Pharos: Q15126(Tbio)
UniProt: Q15126 Q6FGV9
LinkDB All DBs
Structure
PDB: 

Position
1q21.3
AA seq 192 aa AA seqDB search
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQ
RLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFRE
AYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQ
LENLIEFIRSRL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggccccgctgggaggcgccccgcggctggtactgctgttcagcggcaagaggaaatcc
gggaaggacttcgtgaccgaggcgctgcagagcagacttggagctgatgtctgtgctgtc
ctccggctctctggtccactcaaggaacagtatgctcaggagcatggcttgaacttccag
agactcctggacaccagcacctacaaggaggcctttcggaaggacatgatccgctgggga
gaggagaaacgccaggctgacccaggcttcttttgcaggaagattgtggagggcatctcc
cagcccatctggctggtgagtgacacacggagagtgtctgacatccagtggtttcgggag
gcctatggggccgtgacgcagacggtccgcgttgtagcgttggagcagagccgacagcag
cggggctgggtgttcacgccaggggtggacgatgctgagtcagaatgtggcctggacaac
ttcggggactttgactgggtcatcgagaaccatggagttgaacagcgcctggaggagcag
ttggagaacctgatagaatttatccgctccagactttag

DBGET integrated database retrieval system