KEGG   Homo sapiens (human): 10671
Entry
10671             CDS       T01001                                 

Gene name
DCTN6, WS-3, WS3, p27
Definition
(RefSeq) dynactin subunit 6
  KO
K10428  dynactin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    10671 (DCTN6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10671 (DCTN6)
   05016 Huntington disease
    10671 (DCTN6)
   05022 Pathways of neurodegeneration - multiple diseases
    10671 (DCTN6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10671 (DCTN6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     10671 (DCTN6)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     10671 (DCTN6)
SSDB
Motif
Pfam: Hexapep
Other DBs
NCBI-GeneID: 10671
NCBI-ProteinID: NP_006562
OMIM: 612963
HGNC: 16964
Ensembl: ENSG00000104671
Vega: OTTHUMG00000163828
Pharos: O00399(Tdark)
UniProt: O00399
LinkDB
Structure
PDB: 
3TV0

Position
8p12
AA seq 190 aa
MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA
LIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILT
SGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
MKGSSTPVKN
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcggagaagactcaaaagagtgtgaagattgctcctggagcagttgtatgtgtagaa
agtgaaatcagaggagatgtaactatcggacctcggacagtgatccaccctaaagcaaga
attattgcggaagccgggccaatagtgattggcgaagggaacctaatagaagaacaggcc
cttatcataaatgcttacccagataatatcactcctgacactgaagatccagaaccaaaa
cctatgatcattggcaccaataatgtgtttgaagttggctgttattcccaagccatgaag
atgggagataataatgtcattgaatcaaaagcatatgtaggcagaaatgtaatattgaca
agtggctgcatcattggggcttgttgcaacctaaatacatttgaagtcatccctgagaat
acggtgatctatggtgcagactgccttcgtcgggtgcagactgagcgaccgcagccccag
acactacagctggatttcttgatgaaaatcttgccaaattaccaccacctaaagaagact
atgaaaggaagctcaactccagtaaagaactaa

DBGET integrated database retrieval system