KEGG   Homo sapiens (human): 10672Help
Entry
10672             CDS       T01001                                 

Gene name
GNA13, G13
Definition
(RefSeq) G protein subunit alpha 13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04611  Platelet activation
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05130  Pathogenic Escherichia coli infection
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    10672 (GNA13)
   04072 Phospholipase D signaling pathway
    10672 (GNA13)
   04071 Sphingolipid signaling pathway
    10672 (GNA13)
   04022 cGMP-PKG signaling pathway
    10672 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10672 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    10672 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    10672 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10672 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    10672 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10672 (GNA13)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10672 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    10672 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10672 (GNA13)
   04031 GTP-binding proteins [BR:hsa04031]
    10672 (GNA13)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10672 (GNA13)
  Exosomal proteins of colorectal cancer cells
   10672 (GNA13)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    10672 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 10672
NCBI-ProteinID: NP_006563
OMIM: 604406
HGNC: 4381
Ensembl: ENSG00000120063
Vega: OTTHUMG00000179316
Pharos: Q14344(Tbio)
UniProt: Q14344 A0A024R8M0
LinkDB All DBs
Position
17q24.1
AA seq 377 aa AA seqDB search
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD
KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcctgctg
acgagtggcgaggccgagcagcaacgcaagtccaaggagatcgacaaatgcctgtctcgg
gaaaagacctatgtgaagcggctggtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggtt
gatgctcgagagaagcttcatattccctggggagacaactcaaaccaacaacatggagat
aagatgatgtcgtttgatacccgggcccccatggcagcccaaggaatggtggaaacaagg
gttttcttacaatatcttcctgctataagagcattatgggcagacagcggcatacagaat
gcctatgaccggcgtcgagaatttcaactgggtgaatctgtaaaatatttcctggataac
ttggataaacttggagaaccagattatattccatcacaacaagatattctgcttgccaga
agacccaccaaaggcatccatgaatacgactttgaaataaaaaatgttcctttcaaaatg
gttgatgtaggtggtcagagatcagaaaggaaacgttggtttgaatgtttcgacagtgtg
acatcaatacttttccttgtttcctcaagtgaatttgaccaggtgcttatggaagatcga
ctgaccaatcgccttacagagtctctgaacatttttgaaacaatcgtcaataaccgggtt
ttcagcaatgtctccataattctgttcttaaacaagacagacttgcttgaggagaaggtg
caaattgtgagcatcaaagactatttcctagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccggaacaaacgccgggaccagcaacagaag
cccttataccaccacttcaccactgctatcaacacggagaacatccgccttgttttccgt
gacgtgaaggatactattctgcatgacaacctcaagcagcttatgctacagtga

DBGET integrated database retrieval system