KEGG   Homo sapiens (human): 10683Help
Entry
10683             CDS       T01001                                 

Gene name
DLL3, SCDO1
Definition
(RefSeq) delta like canonical Notch ligand 3
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
Disease
H00517  Spondylocostal dysostosis
Drug target
Rovalpituzumab: D11117
Rovalpituzumab tesirine: D10981
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    10683 (DLL3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    10683 (DLL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10683 (DLL3)
  09162 Cancer: specific types
   05224 Breast cancer
    10683 (DLL3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    10683 (DLL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_2 DSL
Motif
Other DBs
NCBI-GeneID: 10683
NCBI-ProteinID: NP_058637
OMIM: 602768
HGNC: 2909
Ensembl: ENSG00000090932
Vega: OTTHUMG00000183067
Pharos: Q9NYJ7(Tbio)
UniProt: Q9NYJ7
LinkDB All DBs
Position
19q13.2
AA seq 618 aa AA seqDB search
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP
PAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA
GQRQHLLFPYPSSILSVK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggtctccccacggatgtccgggctcctctcccagactgtgatcctagcgctcattttc
ctcccccagacacggcccgctggcgtcttcgagctgcagatccactctttcgggccgggt
ccaggccctggggccccgcggtccccctgcagcgcccggctcccctgccgcctcttcttc
agagtctgcctgaagcctgggctctcagaggaggccgccgagtccccgtgcgccctgggc
gcggcgctgagtgcgcgcggaccggtctacaccgagcagcccggagcgcccgcgcctgat
ctcccactgcccgacggcctcttgcaggtgcccttccgggacgcctggcctggcaccttc
tctttcatcatcgaaacctggagagaggagttaggagaccagattggagggcccgcctgg
agcctgctggcgcgcgtggctggcaggcggcgcttggcagccggaggcccgtgggcccgg
gacattcagcgcgcaggcgcctgggagctgcgcttctcgtaccgcgcgcgctgcgagccg
cctgccgtcgggaccgcgtgcacgcgcctctgccgtccgcgcagcgccccctcgcggtgc
ggtccgggactgcgcccctgcgcaccgctcgaggacgaatgtgaggcgccgctggtgtgc
cgagcaggctgcagccctgagcatggcttctgtgaacagcccggtgaatgccgatgccta
gagggctggactggacccctctgcacggtccctgtctccaccagcagctgcctcagcccc
aggggcccgtcctctgctaccaccggatgccttgtccctgggcctgggccctgtgacggg
aacccgtgtgccaatggaggcagctgtagtgagacacccaggtcctttgaatgcacctgc
ccgcgtgggttctacgggctgcggtgtgaggtgagcggggtgacatgtgcagatggaccc
tgcttcaacggcggcttgtgtgtcgggggtgcagaccctgactctgcctacatctgccac
tgcccacccggtttccaaggctccaactgtgagaagagggtggaccggtgcagcctgcag
ccatgccgcaatggcggactctgcctggacctgggccacgccctgcgctgccgctgccgc
gccggcttcgcgggtcctcgctgcgagcacgacctggacgactgcgcgggccgcgcctgc
gctaacggcggcacgtgtgtggagggcggcggcgcgcaccgctgctcctgcgcgctgggc
ttcggcggccgcgactgccgcgagcgcgcggacccgtgcgccgcgcgcccctgtgctcac
ggcggccgctgctacgcccacttctccggcctcgtctgcgcttgcgctcccggctacatg
ggagcgcggtgtgagttcccagtgcaccccgacggcgcaagcgccttgcccgcggccccg
ccgggcctcaggcccggggaccctcagcgctaccttttgcctccggctctgggactgctc
gtggccgcgggcgtggccggcgctgcgctcttgctggtccacgtgcgccgccgtggccac
tcccaggatgctgggtctcgcttgctggctgggaccccggagccgtcagtccacgcactc
ccggatgcactcaacaacctaaggacgcaggagggttccggggatggtccgagctcgtcc
gtagattggaatcgccctgaagatgtagaccctcaagggatttatgtcatatctgctcct
tccatctacgctcgggaggtagcgacgccccttttccccccgctacacactgggcgcgct
gggcagaggcagcacctgctttttccctacccttcctcgattctgtccgtgaaatga

KEGG   Homo sapiens (human): 28514Help
Entry
28514             CDS       T01001                                 

Gene name
DLL1, DELTA1, DL1, Delta
Definition
(RefSeq) delta like canonical Notch ligand 1
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    28514 (DLL1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    28514 (DLL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    28514 (DLL1)
  09162 Cancer: specific types
   05224 Breast cancer
    28514 (DLL1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    28514 (DLL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF MNNL DSL hEGF EGF_2 EGF_CA EGF_3 ECSCR
Motif
Other DBs
NCBI-GeneID: 28514
NCBI-ProteinID: NP_005609
OMIM: 606582
HGNC: 2908
Ensembl: ENSG00000198719
Vega: OTTHUMG00000016078
Pharos: O00548(Tbio)
UniProt: O00548 A0A384P5C6
LinkDB All DBs
Structure
PDB: 

Position
6q27
AA seq 723 aa AA seqDB search
MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
KICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREK
DISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSK
RDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIA
TEV
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtcggtgcgcgctggccctggcggtgctctcggccttgctgtgtcaggtctgg
agctctggggtgttcgaactgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggcgcggggccaccgccgtgcgcctgccggaccttcttc
cgcgtgtgcctcaagcactaccaggccagcgtgtcccccgagccgccctgcacctacggc
agcgccgtcacccccgtgctgggcgtcgactccttcagtctgcccgacggcgggggcgcc
gactccgcgttcagcaaccccatccgcttccccttcggcttcacctggccgggcaccttc
tctctgattattgaagctctccacacagattctcctgatgacctcgcaacagaaaaccca
gaaagactcatcagccgcctggccacccagaggcacctgacggtgggcgaggagtggtcc
caggacctgcacagcagcggccgcacggacctcaagtactcctaccgcttcgtgtgtgac
gaacactactacggagagggctgctccgttttctgccgtccccgggacgatgccttcggc
cacttcacctgtggggagcgtggggagaaagtgtgcaaccctggctggaaagggccctac
tgcacagagccgatctgcctgcctggatgtgatgagcagcatggattttgtgacaaacca
ggggaatgcaagtgcagagtgggctggcagggccggtactgtgacgagtgtatccgctat
ccaggctgtctccatggcacctgccagcagccctggcagtgcaactgccaggaaggctgg
gggggccttttctgcaaccaggacctgaactactgcacacaccataagccctgcaagaat
ggagccacctgcaccaacacgggccaggggagctacacttgctcttgccggcctgggtac
acaggtgccacctgcgagctggggattgacgagtgtgaccccagcccttgtaagaacgga
gggagctgcacggatctcgagaacagctactcctgtacctgcccacccggcttctacggc
aaaatctgtgaattgagtgccatgacctgtgcggacggcccttgctttaacgggggtcgg
tgctcagacagccccgatggagggtacagctgccgctgccccgtgggctactccggcttc
aactgtgagaagaaaattgactactgcagctcttcaccctgttctaatggtgccaagtgt
gtggacctcggtgatgcctacctgtgccgctgccaggccggcttctcggggaggcactgt
gacgacaacgtggacgactgcgcctcctccccgtgcgccaacgggggcacctgccgggat
ggcgtgaacgacttctcctgcacctgcccgcctggctacacgggcaggaactgcagtgcc
cccgtcagcaggtgcgagcacgcaccctgccacaatggggccacctgccacgagaggggc
caccgctatgtgtgcgagtgtgcccgaggctacgggggtcccaactgccagttcctgctc
cccgagctgcccccgggcccagcggtggtggacctcactgagaagctagagggccagggc
gggccattcccctgggtggccgtgtgcgccggggtcatccttgtcctcatgctgctgctg
ggctgtgccgctgtggtggtctgcgtccggctgaggctgcagaagcaccggcccccagcc
gacccctgccggggggagacggagaccatgaacaacctggccaactgccagcgtgagaag
gacatctcagtcagcatcatcggggccacgcagatcaagaacaccaacaagaaggcggac
ttccacggggaccacagcgccgacaagaatggcttcaaggcccgctacccagcggtggac
tataacctcgtgcaggacctcaagggtgacgacaccgccgtcagggacgcgcacagcaag
cgtgacaccaagtgccagccccagggctcctcaggggaggagaaggggaccccgaccaca
ctcaggggtggagaagcatctgaaagaaaaaggccggactcgggctgttcaacttcaaaa
gacaccaagtaccagtcggtgtacgtcatatccgaggagaaggatgagtgcgtcatagca
actgaggtgtaa

KEGG   Homo sapiens (human): 54567Help
Entry
54567             CDS       T01001                                 

Gene name
DLL4, AOS6, delta4, hdelta2
Definition
(RefSeq) delta like canonical Notch ligand 4
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
Disease
H01413  Adams-Oliver syndrome
Drug target
Demcizumab: D10353
Enoticumab: D10460
Navicixizumab: D11126
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    54567 (DLL4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    54567 (DLL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54567 (DLL4)
  09162 Cancer: specific types
   05224 Breast cancer
    54567 (DLL4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    54567 (DLL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 EGF_3 EGF_CA
Motif
Other DBs
NCBI-GeneID: 54567
NCBI-ProteinID: NP_061947
OMIM: 605185
HGNC: 2910
Ensembl: ENSG00000128917
Vega: OTTHUMG00000172511
Pharos: Q9NR61(Tbio)
UniProt: Q9NR61
LinkDB All DBs
Structure
PDB: 

Position
15q15.1
AA seq 685 aa AA seqDB search
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgtcccggagcgcctctggctgggcgctactgctgctggtggcactttgg
cagcagcgcgcggccggctccggcgtcttccagctgcagctgcaggagttcatcaacgag
cgcggcgtactggccagtgggcggccttgcgagcccggctgccggactttcttccgcgtc
tgccttaagcacttccaggcggtcgtctcgcccggaccctgcaccttcgggaccgtctcc
acgccggtattgggcaccaactccttcgctgtccgggacgacagtagcggcggggggcgc
aaccctctccaactgcccttcaatttcacctggccgggtaccttctcgctcatcatcgaa
gcttggcacgcgccaggagacgacctgcggccagaggccttgccaccagatgcactcatc
agcaagatcgccatccagggctccctagctgtgggtcagaactggttattggatgagcaa
accagcaccctcacaaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggagacaactgctcccgcctgtgcaagaagcgcaatgaccacttcggccactatgtgtgc
cagccagatggcaacttgtcctgcctgcccggttggactggggaatattgccaacagcct
atctgtctttcgggctgtcatgaacagaatggctactgcagcaagccagcagagtgcctc
tgccgcccaggctggcagggccggctgtgtaacgaatgcatcccccacaatggctgtcgc
cacggcacctgcagcactccctggcaatgtacttgtgatgagggctggggaggcctgttt
tgtgaccaagatctcaactactgcacccaccactccccatgcaagaatggggcaacgtgc
tccaacagtgggcagcgaagctacacctgcacctgtcgcccaggctacactggtgtggac
tgtgagctggagctcagcgagtgtgacagcaacccctgtcgcaatggaggcagctgtaag
gaccaggaggatggctaccactgcctgtgtcctccgggctactatggcctgcattgtgaa
cacagcaccttgagctgcgccgactccccctgcttcaatgggggctcctgccgggagcgc
aaccagggggccaactatgcttgtgaatgtccccccaacttcaccggctccaactgcgag
aagaaagtggacaggtgcaccagcaacccctgtgccaacgggggacagtgcctgaaccga
ggtccaagccgcatgtgccgctgccgtcctggattcacgggcacctactgtgaactccac
gtcagcgactgtgcccgtaacccttgcgcccacggtggcacttgccatgacctggagaat
gggctcatgtgcacctgccctgccggcttctctggccgacgctgtgaggtgcggacatcc
atcgatgcctgtgcctcgagtccctgcttcaacagggccacctgctacaccgacctctcc
acagacacctttgtgtgcaactgcccttatggctttgtgggcagccgctgcgagttcccc
gtgggcttgccgcccagcttcccctgggtggccgtctcgctgggtgtggggctggcagtg
ctgctggtactgctgggcatggtggcagtggctgtgcggcagctgcggcttcgacggccg
gacgacggcagcagggaagccatgaacaacttgtcggacttccagaaggacaacctgatt
cctgccgcccagcttaaaaacacaaaccagaagaaggagctggaagtggactgtggcctg
gacaagtccaactgtggcaaacagcaaaaccacacattggactataatctggccccaggg
cccctggggcgggggaccatgccaggaaagtttccccacagtgacaagagcttaggagag
aaggcgccactgcggttacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggactccatgtaccagtctgtgtgtttgatatcagaggagaggaatgaatgtgtc
attgccacggaggtataa

DBGET integrated database retrieval system