KEGG   Homo sapiens (human): 10686
Entry
10686             CDS       T01001                                 

Gene name
CLDN16, HOMG3, PCLN1
Definition
(RefSeq) claudin 16
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    10686 (CLDN16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    10686 (CLDN16)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    10686 (CLDN16)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10686 (CLDN16)
  09172 Infectious disease: viral
   05160 Hepatitis C
    10686 (CLDN16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10686 (CLDN16)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   10686 (CLDN16)
  Exosomal proteins of colorectal cancer cells
   10686 (CLDN16)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like aGPT-Pplase3
Other DBs
NCBI-GeneID: 10686
NCBI-ProteinID: NP_006571
OMIM: 603959
HGNC: 2037
Ensembl: ENSG00000113946
Vega: OTTHUMG00000156215
Pharos: Q9Y5I7(Tbio)
UniProt: Q9Y5I7
LinkDB
Position
3q28
AA seq 235 aa
MRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRT
CDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVA
GATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAG
AVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagggatcttcttcaatacatcgcttgcttctttgcctttttctctgctgggtttttg
attgtggccacctggactgactgttggatggtgaatgctgatgactctctggaggtgagc
acaaaatgccgaggcctctggtgggaatgcgtcacaaatgcttttgatgggattcgcacc
tgtgatgagtacgattccatacttgcggagcatcccttgaagctggtggtaactcgagcg
ttgatgattactgcagatattctagctgggtttggatttctcaccctgctccttggtctt
gactgcgtgaaattcctccctgatgagccgtacattaaagtccgcatctgctttgttgct
ggagccacgttactaatagcaggtaccccaggaatcattggctctgtgtggtatgctgtt
gatgtgtatgtggaacgttctactttggttttgcacaatatatttcttggtatccaatat
aaatttggttggtcctgttggctcggaatggctgggtctctgggttgctttttggctgga
gctgttctcacctgctgcttatatctttttaaagatgttggacctgagagaaactatcct
tattccttgaggaaagcctattcagccgcgggtgtttccatggccaagtcatactcagcc
cctcgcacagagacggccaaaatgtatgctgtagacacaagggtgtaa

DBGET integrated database retrieval system