KEGG   Homo sapiens (human): 107Help
Entry
107               CDS       T01001                                 

Gene name
ADCY1, AC1, DFNB44
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05142  Chagas disease (American trypanosomiasis)
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00782  TSH-thyroglobulin signaling pathway
N00783  Mutation-inactivated TSH to TSH-thyroglobulin signaling pathway
N00784  Mutation-inactivated TSHR to TSH-thyroglobulin signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-thyroglobulin signaling pathway
N00797  Mutation-activated TSHR to TSH-thyroglobulin signaling pathway
Disease
H00605  Deafness, autosomal recessive
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107 (ADCY1)
   04371 Apelin signaling pathway
    107 (ADCY1)
   04020 Calcium signaling pathway
    107 (ADCY1)
   04072 Phospholipase D signaling pathway
    107 (ADCY1)
   04024 cAMP signaling pathway
    107 (ADCY1)
   04022 cGMP-PKG signaling pathway
    107 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107 (ADCY1)
   04062 Chemokine signaling pathway
    107 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    107 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    107 (ADCY1)
   04912 GnRH signaling pathway
    107 (ADCY1)
   04913 Ovarian steroidogenesis
    107 (ADCY1)
   04915 Estrogen signaling pathway
    107 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    107 (ADCY1)
   04921 Oxytocin signaling pathway
    107 (ADCY1)
   04926 Relaxin signaling pathway
    107 (ADCY1)
   04918 Thyroid hormone synthesis
    107 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    107 (ADCY1)
   04916 Melanogenesis
    107 (ADCY1)
   04925 Aldosterone synthesis and secretion
    107 (ADCY1)
   04927 Cortisol synthesis and secretion
    107 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107 (ADCY1)
   04270 Vascular smooth muscle contraction
    107 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    107 (ADCY1)
   04971 Gastric acid secretion
    107 (ADCY1)
   04972 Pancreatic secretion
    107 (ADCY1)
   04976 Bile secretion
    107 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107 (ADCY1)
   04727 GABAergic synapse
    107 (ADCY1)
   04725 Cholinergic synapse
    107 (ADCY1)
   04720 Long-term potentiation
    107 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    107 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    107 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    107 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107 (ADCY1)
   04714 Thermogenesis
    107 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    107 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    107 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107 (ADCY1)
   05163 Human cytomegalovirus infection
    107 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107 (ADCY1)
   05142 Chagas disease (American trypanosomiasis)
    107 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107 (ADCY1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107 (ADCY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Motif
Other DBs
NCBI-GeneID: 107
NCBI-ProteinID: NP_066939
OMIM: 103072
HGNC: 232
Ensembl: ENSG00000164742
Vega: OTTHUMG00000155420
Pharos: Q08828(Tchem)
UniProt: Q08828
LinkDB All DBs
Position
7p12.3
AA seq 1119 aa AA seqDB search
MAGAPRGGGGGGGGAGEPGGAERAAGTSRRRGLRACDEEFACPELEALFRGYTLRLEQAA
TLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQ
QVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVR
SLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFVGVNMYGVFVRILTERSQR
KAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHD
NVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGL
TQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSH
RRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALR
TASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQK
YHQLQDEYFTSAVVLTLILAALFGLVYLLIFPQSVVVLLLLVFCICFLVACVLYLHITRV
QCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSKPNSSLVVLSSGGQRTALP
TLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGAV
SGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEI
IADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFD
VLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQV
TEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQIRSLGLDRKMCPFGRA
GLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggcggaggcggcggcggaggcggcgcgggcgagcccgggggc
gccgagcgggcggccgggacaagccgccggcgcgggctccgggcgtgcgacgaggagttc
gcttgcccagagctggaggcgctgttccgcggctacacgctgcggctggagcaggcggcc
acgctgaaggcgctggccgttctcagcctgctggcgggcgcgctggcgctggccgagctg
ctgggcgcgccggggcccgcgcccggcctggccaagggctcacacccggtgcactgcgtc
ctcttcctggcgctgctcgtggtaaccaacgtccggtccctgcaggtgccccagctgcag
caggtcggccagctggcgctgctcttcagcctcaccttcgcgctgctctgctgtcctttc
gcgctgggcggccccgcccggggttccgccggggccgctggggggccagcgaccgccgaa
caaggggtttggcagctccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgc
agcctgctggccataggctttgggctcgtggtggctgcgtcgcacttgctggtcacagcc
accttggtccccgccaagcgcccacgtctctggaggacgctcggtgccaatgccttgctc
ttcgtcggtgtgaacatgtatggggtctttgtgcggattctgactgagcgttcacagagg
aaggcgttcctgcaggcccggagctgcattgaggaccgactgaggctggaggatgagaac
gagaagcaggagcggctcctcatgagcctcctgccccggaacgttgccatggagatgaag
gaggacttcctgaagccccctgagaggattttccacaagatttacatccagaggcacgac
aatgtgagcatcctgtttgctgacatcgtgggtttcacgggcttggcatcccagtgcaca
gcccaggagctggtgaaactcctcaatgagctcttcggcaagttcgatgaattagccacg
gagaaccactgtcgccgcatcaagattctcggggactgctactactgcgtgtcgggcctc
acccagcccaagactgaccatgcccactgctgtgtggagatgggactcgacatgattgat
accatcacatctgtggctgaagccaccgaggtggatctgaacatgcgtgtgggtctgcac
acgggcagggtcctctgtggtgtcctgggcttgcgcaagtggcagtacgacgtgtggtcc
aatgatgtgaccttggccaatgtcatggaagccgctggcctgccagggaaggttcatatc
acaaagacgaccctagcgtgcttgaatggggactacgaggtagaaccgggttacggacat
gagaggaacagtttcttgaaaactcataacatcgaaaccttttttattgtgccatcccat
cgccgaaagatatttccaggcctgattctctcagatataaaaccggccaaaaggatgaag
ttcaagactgtctgctacctgctggtgcagctcatgcactgccggaaaatgttcaaggcc
gagatccccttctccaatgtcatgacctgcgaggacgatgacaagcggagggcattaaga
acagcctcggaaaaactcagaaaccgctcatctttttctaccaacgttgtctacaccacc
ccgggcactcgcgtcaacaggtacatcagccgcctcttagaagcccgccagacagagctg
gagatggcagacctgaacttctttaccctgaagtacaaacatgtcgaacgggagcaaaag
taccaccagcttcaggacgagtatttcaccagcgccgttgtcctcaccctcatcctggct
gccttatttggccttgtctaccttctaatattcccacagagtgtggtcgtcctgctcctg
ctagtattctgcatctgcttcctggtggcctgtgtcctgtacctgcacatcacccgggtc
cagtgttttccagggtgcctgacgattcagattcgcactgtcctgtgtattttcatagtg
gtcttaatctactcagtagcccaaggttgtgtggtgggctgcctgccttgggcctggagc
tccaagcccaacagttccctggtggtcctttcgtctgggggccagcgcacagccctgccc
accctgccctgcgagtctacacaccatgccctgctctgctgcctggtgggcaccctcccg
ctagccatatttttccgggtgtcctccttgccaaaaatgatcctgctctccgggctcacc
acgtcctacatcctcgttctggagctcagcggatacaccaggactgggggtggtgccgtc
tccgggcgcagctacgagccgattgtggccatcctgctcttctcctgtgcgctggccctg
catgccaggcaggtggacatcaggctgaggctggactacctctgggccgcacaggcagag
gaggagcgagaggacatggagaaggtgaagctggacaacaggcgcatcctcttcaacctc
ctgccggcccacgtcgcccagcacttcctcatgtccaaccctcggaacatggacctctac
taccagtcctactcccaggtgggcgtcatgtttgcctccatccccaacttcaatgacttc
tacatcgagctggacggcaacaacatgggggtggagtgtctgcggcttctcaacgagatc
atcgccgactttgacgagctcatggaaaaagacttttacaaggacatagagaagatcaag
accatcgggagcacctacatggccgctgtggggctagcgcccacctcggggaccaaggct
aagaagtccatctcctcccacctgagcacgctggcggactttgccattgagatgtttgac
gttctggatgaaatcaactaccagtcttacaacgactttgtcctccgagttggcatcaat
gttggccctgtggtggctggagtgattggcgctcgcaggccccagtacgacatctgggga
aacacagtcaacgtggccagtcggatggatagcacaggggtccagggcagaatccaggtg
actgaggaagtccaccggctgctgagaaggtgcccctaccactttgtgtgccgaggcaaa
gtcagtgtcaagggcaaaggcgagatgttgacatactttctagaaggcaggactgatgga
aacggctcccaaatcaggtccctgggcttggatcggaaaatgtgtccatttgggagagct
ggccttcagggcagacgtccccccgtgtgccccatgcctggcgtctcagtcagggctggg
ctccctccacactccccaggccagtacctgccctctgcagcagctgggaaggaggcttag

DBGET integrated database retrieval system