KEGG   Homo sapiens (human): 107Help
Entry
107               CDS       T01001                                 

Gene name
ADCY1, AC1, DFNB44
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05142  Chagas disease (American trypanosomiasis)
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Disease
H00605  Deafness, autosomal recessive
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107 (ADCY1)
   04371 Apelin signaling pathway
    107 (ADCY1)
   04020 Calcium signaling pathway
    107 (ADCY1)
   04072 Phospholipase D signaling pathway
    107 (ADCY1)
   04024 cAMP signaling pathway
    107 (ADCY1)
   04022 cGMP-PKG signaling pathway
    107 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107 (ADCY1)
   04062 Chemokine signaling pathway
    107 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    107 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    107 (ADCY1)
   04912 GnRH signaling pathway
    107 (ADCY1)
   04913 Ovarian steroidogenesis
    107 (ADCY1)
   04915 Estrogen signaling pathway
    107 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    107 (ADCY1)
   04921 Oxytocin signaling pathway
    107 (ADCY1)
   04926 Relaxin signaling pathway
    107 (ADCY1)
   04918 Thyroid hormone synthesis
    107 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    107 (ADCY1)
   04916 Melanogenesis
    107 (ADCY1)
   04925 Aldosterone synthesis and secretion
    107 (ADCY1)
   04927 Cortisol synthesis and secretion
    107 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107 (ADCY1)
   04270 Vascular smooth muscle contraction
    107 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    107 (ADCY1)
   04971 Gastric acid secretion
    107 (ADCY1)
   04972 Pancreatic secretion
    107 (ADCY1)
   04976 Bile secretion
    107 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107 (ADCY1)
   04727 GABAergic synapse
    107 (ADCY1)
   04725 Cholinergic synapse
    107 (ADCY1)
   04720 Long-term potentiation
    107 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    107 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    107 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    107 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107 (ADCY1)
   04714 Thermogenesis
    107 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    107 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    107 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107 (ADCY1)
   05163 Human cytomegalovirus infection
    107 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107 (ADCY1)
   05142 Chagas disease (American trypanosomiasis)
    107 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107 (ADCY1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107 (ADCY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Motif
Other DBs
NCBI-GeneID: 107
NCBI-ProteinID: NP_066939
OMIM: 103072
HGNC: 232
Ensembl: ENSG00000164742
Vega: OTTHUMG00000155420
Pharos: Q08828(Tchem)
UniProt: Q08828
LinkDB All DBs
Position
7p12.3
AA seq 1119 aa AA seqDB search
MAGAPRGGGGGGGGAGEPGGAERAAGTSRRRGLRACDEEFACPELEALFRGYTLRLEQAA
TLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQ
QVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVR
SLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFVGVNMYGVFVRILTERSQR
KAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHD
NVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGL
TQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSH
RRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALR
TASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQK
YHQLQDEYFTSAVVLTLILAALFGLVYLLIFPQSVVVLLLLVFCICFLVACVLYLHITRV
QCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSKPNSSLVVLSSGGQRTALP
TLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGAV
SGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEI
IADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFD
VLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQV
TEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQIRSLGLDRKMCPFGRA
GLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggcggaggcggcggcggaggcggcgcgggcgagcccgggggc
gccgagcgggcggccgggacaagccgccggcgcgggctccgggcgtgcgacgaggagttc
gcttgcccagagctggaggcgctgttccgcggctacacgctgcggctggagcaggcggcc
acgctgaaggcgctggccgttctcagcctgctggcgggcgcgctggcgctggccgagctg
ctgggcgcgccggggcccgcgcccggcctggccaagggctcacacccggtgcactgcgtc
ctcttcctggcgctgctcgtggtaaccaacgtccggtccctgcaggtgccccagctgcag
caggtcggccagctggcgctgctcttcagcctcaccttcgcgctgctctgctgtcctttc
gcgctgggcggccccgcccggggttccgccggggccgctggggggccagcgaccgccgaa
caaggggtttggcagctccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgc
agcctgctggccataggctttgggctcgtggtggctgcgtcgcacttgctggtcacagcc
accttggtccccgccaagcgcccacgtctctggaggacgctcggtgccaatgccttgctc
ttcgtcggtgtgaacatgtatggggtctttgtgcggattctgactgagcgttcacagagg
aaggcgttcctgcaggcccggagctgcattgaggaccgactgaggctggaggatgagaac
gagaagcaggagcggctcctcatgagcctcctgccccggaacgttgccatggagatgaag
gaggacttcctgaagccccctgagaggattttccacaagatttacatccagaggcacgac
aatgtgagcatcctgtttgctgacatcgtgggtttcacgggcttggcatcccagtgcaca
gcccaggagctggtgaaactcctcaatgagctcttcggcaagttcgatgaattagccacg
gagaaccactgtcgccgcatcaagattctcggggactgctactactgcgtgtcgggcctc
acccagcccaagactgaccatgcccactgctgtgtggagatgggactcgacatgattgat
accatcacatctgtggctgaagccaccgaggtggatctgaacatgcgtgtgggtctgcac
acgggcagggtcctctgtggtgtcctgggcttgcgcaagtggcagtacgacgtgtggtcc
aatgatgtgaccttggccaatgtcatggaagccgctggcctgccagggaaggttcatatc
acaaagacgaccctagcgtgcttgaatggggactacgaggtagaaccgggttacggacat
gagaggaacagtttcttgaaaactcataacatcgaaaccttttttattgtgccatcccat
cgccgaaagatatttccaggcctgattctctcagatataaaaccggccaaaaggatgaag
ttcaagactgtctgctacctgctggtgcagctcatgcactgccggaaaatgttcaaggcc
gagatccccttctccaatgtcatgacctgcgaggacgatgacaagcggagggcattaaga
acagcctcggaaaaactcagaaaccgctcatctttttctaccaacgttgtctacaccacc
ccgggcactcgcgtcaacaggtacatcagccgcctcttagaagcccgccagacagagctg
gagatggcagacctgaacttctttaccctgaagtacaaacatgtcgaacgggagcaaaag
taccaccagcttcaggacgagtatttcaccagcgccgttgtcctcaccctcatcctggct
gccttatttggccttgtctaccttctaatattcccacagagtgtggtcgtcctgctcctg
ctagtattctgcatctgcttcctggtggcctgtgtcctgtacctgcacatcacccgggtc
cagtgttttccagggtgcctgacgattcagattcgcactgtcctgtgtattttcatagtg
gtcttaatctactcagtagcccaaggttgtgtggtgggctgcctgccttgggcctggagc
tccaagcccaacagttccctggtggtcctttcgtctgggggccagcgcacagccctgccc
accctgccctgcgagtctacacaccatgccctgctctgctgcctggtgggcaccctcccg
ctagccatatttttccgggtgtcctccttgccaaaaatgatcctgctctccgggctcacc
acgtcctacatcctcgttctggagctcagcggatacaccaggactgggggtggtgccgtc
tccgggcgcagctacgagccgattgtggccatcctgctcttctcctgtgcgctggccctg
catgccaggcaggtggacatcaggctgaggctggactacctctgggccgcacaggcagag
gaggagcgagaggacatggagaaggtgaagctggacaacaggcgcatcctcttcaacctc
ctgccggcccacgtcgcccagcacttcctcatgtccaaccctcggaacatggacctctac
taccagtcctactcccaggtgggcgtcatgtttgcctccatccccaacttcaatgacttc
tacatcgagctggacggcaacaacatgggggtggagtgtctgcggcttctcaacgagatc
atcgccgactttgacgagctcatggaaaaagacttttacaaggacatagagaagatcaag
accatcgggagcacctacatggccgctgtggggctagcgcccacctcggggaccaaggct
aagaagtccatctcctcccacctgagcacgctggcggactttgccattgagatgtttgac
gttctggatgaaatcaactaccagtcttacaacgactttgtcctccgagttggcatcaat
gttggccctgtggtggctggagtgattggcgctcgcaggccccagtacgacatctgggga
aacacagtcaacgtggccagtcggatggatagcacaggggtccagggcagaatccaggtg
actgaggaagtccaccggctgctgagaaggtgcccctaccactttgtgtgccgaggcaaa
gtcagtgtcaagggcaaaggcgagatgttgacatactttctagaaggcaggactgatgga
aacggctcccaaatcaggtccctgggcttggatcggaaaatgtgtccatttgggagagct
ggccttcagggcagacgtccccccgtgtgccccatgcctggcgtctcagtcagggctggg
ctccctccacactccccaggccagtacctgccctctgcagcagctgggaaggaggcttag

KEGG   Homo sapiens (human): 108Help
Entry
108               CDS       T01001                                 

Gene name
ADCY2, AC2, HBAC2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108 (ADCY2)
   04371 Apelin signaling pathway
    108 (ADCY2)
   04020 Calcium signaling pathway
    108 (ADCY2)
   04072 Phospholipase D signaling pathway
    108 (ADCY2)
   04024 cAMP signaling pathway
    108 (ADCY2)
   04022 cGMP-PKG signaling pathway
    108 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108 (ADCY2)
   04062 Chemokine signaling pathway
    108 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    108 (ADCY2)
   04922 Glucagon signaling pathway
    108 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    108 (ADCY2)
   04912 GnRH signaling pathway
    108 (ADCY2)
   04913 Ovarian steroidogenesis
    108 (ADCY2)
   04915 Estrogen signaling pathway
    108 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    108 (ADCY2)
   04921 Oxytocin signaling pathway
    108 (ADCY2)
   04926 Relaxin signaling pathway
    108 (ADCY2)
   04918 Thyroid hormone synthesis
    108 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    108 (ADCY2)
   04916 Melanogenesis
    108 (ADCY2)
   04925 Aldosterone synthesis and secretion
    108 (ADCY2)
   04927 Cortisol synthesis and secretion
    108 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108 (ADCY2)
   04270 Vascular smooth muscle contraction
    108 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    108 (ADCY2)
   04971 Gastric acid secretion
    108 (ADCY2)
   04972 Pancreatic secretion
    108 (ADCY2)
   04976 Bile secretion
    108 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    108 (ADCY2)
   04727 GABAergic synapse
    108 (ADCY2)
   04725 Cholinergic synapse
    108 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    108 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    108 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    108 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108 (ADCY2)
   04714 Thermogenesis
    108 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    108 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    108 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108 (ADCY2)
   05163 Human cytomegalovirus infection
    108 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108 (ADCY2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108 (ADCY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Motif
Other DBs
NCBI-GeneID: 108
NCBI-ProteinID: NP_065433
OMIM: 103071
HGNC: 233
Ensembl: ENSG00000078295
Vega: OTTHUMG00000090476
Pharos: Q08462(Tbio)
UniProt: Q08462 Q71UM8
LinkDB All DBs
Position
5p15.31
AA seq 1091 aa AA seqDB search
MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP
LLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFS
ASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHT
HAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHS
QEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcgccgccgctacctgcgggaccgctccgaggaggcggcg
ggcggcggagacgggctgccgcggtcccgggactggctctacgagtcctactactgcatg
agccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggctcctgcctcgcc
ctgctcgccgtcttcttcgcgctcgggctggaagttgaagaccatgtggcgtttctaata
acagttccaactgccctggcgattttctttgcgatatttatcctggtctgcatcgagtct
gtgtttaagaagctgctgcgcctcttctcgttggtgatatggatatgccttgttgccatg
ggatacctgttcatgtgttttggaggcaccgtctctccctgggaccaggtatcgttcttc
ctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagacgccatcatt
gccagcgtcctcacctcctcctcccacaccatcgtgcttagcgtctgcctgtctgcaaca
ccgggaggcaaggagcacctggtctggcagatcctggccaatgtgatcattttcatctgt
gggaacctggcgggagcctaccataagcacctcatggaactcgctcttcagcaaacatat
caggacacctgtaattgcatcaagtcgcggatcaagttggaatttgaaaaacgtcaacag
gagcggcttctgctctccctgctgccggcccacatcgccatggagatgaaagcggagatc
atccagaggctgcagggccccaaggcgggccagatggagaacacaaataacttccacaac
ctgtatgtgaagcggcatacaaacgtgagcatcttatacgctgacatcgttggctttacc
cggctggcaagtgactgctccccgggagaactagtccacatgctgaatgagctctttgga
aagtttgatcaaattgcaaaggagaatgaatgcatgagaattaaaattttaggagactgc
tactactgtgtatctggactccctatatctctccctaaccatgccaagaactgtgtgaaa
atggggctggacatgtgtgaagccataaagaaagtgagggatgctactggagttgatatc
aacatgcgcgtgggcgtgcattctgggaatgtcctgtgtggcgtgattggtctgcagaag
tggcaatatgatgtgtggtcacatgatgtgaccttggccaaccacatggaagctggaggg
gtccctggacgtgttcacatttcttctgtcaccctggagcacttgaatggcgcttataaa
gtggaggagggagatggtgacattagggacccatatttaaaacagcacctggtgaaaacc
tactttgtgatcaaccccaagggagaacgacggagcccccagcatctcttcagacctcgc
cacacccttgatggagccaaaatgagggcctcggtccgcatgacccggtacttggagtcc
tggggggcagccaagccctttgcacacctacatcacagggacagcatgaccacagagaac
ggcaagatcagcaccacggatgtacccatgggtcagcataattttcaaaatcgcacctta
agaaccaagtcacaaaagaagagatttgaagaagaattgaatgaaaggatgattcaagca
attgatgggattaatgcacagaagcaatggctcaagtctgaagacattcagagaatctca
ctgcttttctataacaaagtactagaaaaagagtaccgggccacggcactgccagcgttc
aagtattatgtgacttgtgcctgtctcatattcttctgcatcttcattgtgcagattctc
gtgctgccaaaaacgtccgtcctgggcatctcctttggggctgcgtttctcttgctggcc
ttcatcctcttcgtctgctttgctggacagcttctgcaatgcagcaaaaaagcctctccc
ctgctcatgtggcttttgaagtcctcgggcatcattgccaaccgcccctggccacggatc
tctctcacgatcatcaccacagccatcatattaatgatggccgtgttcaacatgtttttc
ctgagtgactcagaggaaacaatccctccaactgccaacacaacaaacacaagcttttca
gcctcaaataatcaggtggcgattctgcgtgcgcagaatttatttttcctcccgtacttt
atctacagctgcattctgggactgatatcctgttccgtgttcctgcgggtaaactatgag
ctgaagatgttgatcatgatggtggccttggtgggctacaacaccatcctactccacacc
cacgcccacgtcctgggcgactacagccaggtcttatttgagagaccaggcatttggaaa
gacctgaagaccatgggctctgtgtctctctctatattcttcatcacactgcttgttctg
ggtagacagaatgaatattactgtaggttagacttcttatggaagaacaaattcaaaaaa
gagcgggaggagatagagaccatggagaacctgaaccgcgtgctgctggagaacgtgctt
cccgcgcacgtggctgagcacttcctggccaggagcctgaagaatgaggagctataccac
cagtcctatgactgcgtctgcgtcatgtttgcctccattccggatttcaaagaattttat
acagaatccgacgtgaacaaggagggcttggaatgccttcggctcctgaacgagatcatc
gctgactttgatgatcttctttccaagccaaaattcagtggagttgaaaagattaagacc
attggcagcacatacatggcagcaacaggtctgagcgctgtgcccagccaggagcactcc
caggagcccgagcggcagtacatgcacattggcaccatggtggagtttgcttttgccctg
gtagggaagctggatgccatcaacaagcactccttcaacgacttcaaattgcgagtgggt
attaaccatggacctgtgatagctggtgtgattggagctcagaagccacaatatgatatc
tggggcaacactgtcaatgtggccagtaggatggacagcaccggagtcctggacaaaata
caggttaccgaggagacgagcctcgtcctgcagaccctcggatacacgtgcacctgtcga
ggaataatcaacgtgaaaggaaagggggacctgaagacgtactttgtaaacacagaaatg
tcaaggtccctttcccagagcaacgtggcatcctga

KEGG   Homo sapiens (human): 109Help
Entry
109               CDS       T01001                                 

Gene name
ADCY3, AC-III, AC3, BMIQ19
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04740  Olfactory transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05110  Vibrio cholerae infection
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Disease
H02106  Genetic obesity
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109 (ADCY3)
   04371 Apelin signaling pathway
    109 (ADCY3)
   04020 Calcium signaling pathway
    109 (ADCY3)
   04072 Phospholipase D signaling pathway
    109 (ADCY3)
   04024 cAMP signaling pathway
    109 (ADCY3)
   04022 cGMP-PKG signaling pathway
    109 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109 (ADCY3)
   04062 Chemokine signaling pathway
    109 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    109 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    109 (ADCY3)
   04912 GnRH signaling pathway
    109 (ADCY3)
   04913 Ovarian steroidogenesis
    109 (ADCY3)
   04915 Estrogen signaling pathway
    109 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    109 (ADCY3)
   04921 Oxytocin signaling pathway
    109 (ADCY3)
   04926 Relaxin signaling pathway
    109 (ADCY3)
   04918 Thyroid hormone synthesis
    109 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    109 (ADCY3)
   04916 Melanogenesis
    109 (ADCY3)
   04925 Aldosterone synthesis and secretion
    109 (ADCY3)
   04927 Cortisol synthesis and secretion
    109 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109 (ADCY3)
   04270 Vascular smooth muscle contraction
    109 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    109 (ADCY3)
   04971 Gastric acid secretion
    109 (ADCY3)
   04972 Pancreatic secretion
    109 (ADCY3)
   04976 Bile secretion
    109 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    109 (ADCY3)
   04727 GABAergic synapse
    109 (ADCY3)
   04725 Cholinergic synapse
    109 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    109 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    109 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    109 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    109 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    109 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109 (ADCY3)
   04714 Thermogenesis
    109 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    109 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109 (ADCY3)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    109 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109 (ADCY3)
   05163 Human cytomegalovirus infection
    109 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109 (ADCY3)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109 (ADCY3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N HNOBA RAP1 fn3_4 OPA3 Peptidase_S49_N
Motif
Other DBs
NCBI-GeneID: 109
NCBI-ProteinID: NP_004027
OMIM: 600291
HGNC: 234
Ensembl: ENSG00000138031
Vega: OTTHUMG00000094765
Pharos: O60266(Tbio)
UniProt: O60266
LinkDB All DBs
Position
2p23.3
AA seq 1144 aa AA seqDB search
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLASLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVLPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKY
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQV
VDNS
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgaatactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgactttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgcagccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggcttccctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtgctgccc
tacgtgctgtggctgctcataaccgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggctagtgacacggtgggctggcaggtcttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacacgttggtcctgggggtcaccgtggcccagcagcagcaggaggagctcaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgtcacgagaacgtcagcatc
ctctttgccgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctt
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcttgcccgactaccgg
gaggaccacgccgtctgctccatcctcatggggctggccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtcgactgatgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggagccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcaccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaacgggagtgcccacagc
agtgggtccacgtcggagaagcccgaggagcaggatgcccaggccgacaacccctcattc
cccaacccacgccggaggctgcgcctgcaggacctggctgaccgagtggtggatgcctct
gaagatgagcacgagctcaaccagctgctcaacgaggccctgcttgagcgagagtccgcc
caagtagtaaagaagagaaacaccttcctcttgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggccctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcatggtgggggagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcaacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacgggacccagcaatgcaacggcaggg
atggaaacggagggcagctgcctggagaaccccaagtattacaactatgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcgtcgcaggcgccgtggccaccatcaacctctatgcctggcgtcccgtctttgat
gaatacgaccacaagcgttttcgggagcacgacttacctatggtggccttagagcagatg
caaggattcaaccctgggctcaatggcactgacaggctgcccctggtgccttccaagtac
tctatgacggtgatggtgttcctcatgatgctcagcttctactacttctcccgccacgta
gaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaacgt
gtctatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcacgtg
gcacgccatttcctggggtccaagaagagagatgaggagctgtatagccagacgtatgat
gagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggagagc
atcaacaatggtggtattgagtgtctgcgtttcctcaatgaaatcatctcagattttgac
tctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagcacg
tatatggcggcttcaggagtcacccccgatgtcaacaccaatggctttgccagctccaac
aaggaagacaagtccgagagagagcgctggcagcacctggctgacctggccgacttcgcg
ctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatgctg
cgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaaccacac
tacgacatctggggcaatacagtcaatgtagccagcaggatggagtccacgggggtcatg
ggcaacattcaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgcttt
gtgaggcgaggccccatctttgtgaaggggaagggggagctgctgaccttcttcttgaag
gggcgggataagctagccaccttccccaatggcccctctgtcacactgccccaccaggtg
gtggacaactcctga

KEGG   Homo sapiens (human): 111Help
Entry
111               CDS       T01001                                 

Gene name
ADCY5, AC5, FDFM
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111 (ADCY5)
   04371 Apelin signaling pathway
    111 (ADCY5)
   04072 Phospholipase D signaling pathway
    111 (ADCY5)
   04024 cAMP signaling pathway
    111 (ADCY5)
   04022 cGMP-PKG signaling pathway
    111 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111 (ADCY5)
   04062 Chemokine signaling pathway
    111 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    111 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    111 (ADCY5)
   04912 GnRH signaling pathway
    111 (ADCY5)
   04913 Ovarian steroidogenesis
    111 (ADCY5)
   04915 Estrogen signaling pathway
    111 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    111 (ADCY5)
   04921 Oxytocin signaling pathway
    111 (ADCY5)
   04926 Relaxin signaling pathway
    111 (ADCY5)
   04918 Thyroid hormone synthesis
    111 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    111 (ADCY5)
   04916 Melanogenesis
    111 (ADCY5)
   04924 Renin secretion
    111 (ADCY5)
   04925 Aldosterone synthesis and secretion
    111 (ADCY5)
   04927 Cortisol synthesis and secretion
    111 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111 (ADCY5)
   04270 Vascular smooth muscle contraction
    111 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    111 (ADCY5)
   04971 Gastric acid secretion
    111 (ADCY5)
   04972 Pancreatic secretion
    111 (ADCY5)
   04976 Bile secretion
    111 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    111 (ADCY5)
   04727 GABAergic synapse
    111 (ADCY5)
   04725 Cholinergic synapse
    111 (ADCY5)
   04728 Dopaminergic synapse
    111 (ADCY5)
   04726 Serotonergic synapse
    111 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    111 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    111 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    111 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111 (ADCY5)
   04714 Thermogenesis
    111 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    111 (ADCY5)
   05031 Amphetamine addiction
    111 (ADCY5)
   05032 Morphine addiction
    111 (ADCY5)
   05034 Alcoholism
    111 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    111 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111 (ADCY5)
   05163 Human cytomegalovirus infection
    111 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111 (ADCY5)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111 (ADCY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD HILPDA
Motif
Other DBs
NCBI-GeneID: 111
NCBI-ProteinID: NP_899200
OMIM: 600293
HGNC: 236
Ensembl: ENSG00000173175
Vega: OTTHUMG00000159517
Pharos: O95622(Tchem)
UniProt: O95622 A0A384P5Q5 B7Z2C7
LinkDB All DBs
Position
3q21.1
AA seq 1261 aa AA seqDB search
MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAASGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVEG
GEGSGDGGSSADSGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQS
SLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMGL
ACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSAL
HLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLH
SQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTS
LASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEM
GMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGK
AGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMN
RQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFL
GRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQI
TIVPHSIFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGVF
TITLVFLAAFVNMFTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSP
WPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADL
LVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKL
QATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANF
SEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTY
DKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWG
NTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPL
S
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgcggcgcagaagactgcggcgccg
gcgccccggggaggccccgaacaccgctctgcgtggggcgaggccgattcccgcgcgaat
ggctacccccatgcccccgggggctctgcccgcggctccaccaagaaacccgggggggcg
gtgaccccgcagcagcagcagcgcctggccagccgctggcgcagcgacgacgacgacgat
cctccgctgagcggtgacgaccccctggccgggggcttcggcttcagcttccgctccaag
tccgcctggcaggagcgcggcggcgacgactgcggtcgcggcagccgccggcagcggcgg
ggcgcggccagcgggggcagcacccgggcgccccctgcgggcggcggcggcggctcggcg
gcggcggctgcctcggcgggcgggacggaggtgcgccctcgctcggtggaggtgggtctg
gaggagcggcggggcaaggggcgcgcggccgacgagctggaggccggcgccgtcgagggc
ggcgaggggtccggggatggcggcagctcggcggactcgggctcgggcgcggggcccggc
gcggtgctgtccctgggcgcctgctgcctggcgttgctgcagatattccgctccaagaag
ttcccgtcggacaaactggagcggctgtaccagcgctacttcttccgcctgaaccagagc
agcctcaccatgctcatggccgtgctggtgctcgtgtgcctggtcatgttggccttccac
gcggcgcggcccccgctccagctgccctacctggccgtgctggcggccgccgtcggcgtg
atcctcatcatggctgtgctttgcaaccgcgccgccttccaccaggaccacatgggcctg
gcctgctatgcgctcatcgccgtggtgctggccgtccaggtggtgggcctgctgctgccg
cagccacgcagcgcctctgagggcatctggtggaccgtgttcttcatctacaccatctac
acgctgctgcccgtgcgcatgcgggccgcagtgctcagcggggtgctcctgtccgccctc
cacctggccatcgccctgcgcaccaacgcccaggaccagttcctgctgaagcagcttgtc
tccaatgttctcattttctcctgcaccaacatcgtgggtgtctgcacccactatccggct
gaggtctcccagagacaggctttccaggagacccgagagtgcatccaggcgcggctccac
tcgcagcgggagaaccagcagcaggaacggctcctgctgtctgtccttccccgtcatgtt
gccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccataagatt
tacatccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggcttcaccagc
ctggcgtcccagtgcactgcacaggaactggtcatgaccctcaacgagctcttcgcccgc
tttgacaagctggccgcagagaatcactgtttacgtattaagatccttggggattgttat
tactgcgtctcggggctgcctgaagcaagggctgaccacgcccactgctgtgtggagatg
ggcatggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaacgtgaac
atgcgtgtgggaattcacagcgggcgagtacactgcggtgtccttggtctcaggaagtgg
cagttcgacgtctggtctaacgatgtcacgctagccaaccacatggaggctggcggcaag
gcaggacgcatccacatcaccaaggctacactcaactacctgaatggggactacgaggtg
gagccaggctgtgggggcgagcgcaacgcctacctcaaggagcacagtatcgagaccttc
ctcatcctgcgctgcacccagaagcggaaagaagagaaggccatgatcgccaagatgaac
cgccagagaaccaactccatcgggcacaacccaccacactggggggctgagcgccccttc
tacaaccacctgggtggcaaccaggtgtccaaggagatgaagcggatgggctttgaagac
cccaaggacaagaacgcccaggagagtgcgaaccctgaggatgaagtggatgagtttctg
ggccgtgccattgacgccaggagcattgataggcttcggtctgagcacgtccgcaagttc
ctcctgaccttcagggagcctgacttagagaagaagtactccaagcaggtagacgaccga
tttggtgcctatgtggcgtgtgcctcgctcgtcttcctcttcatctgctttgtccagatc
accatcgtgccccactccatattcatgctcagcttctacctgacctgttccctgctgctg
accttggtggtgtttgtgtctgtgatctactcctgcgtaaagctcttcccctccccactg
cagaccctctccaggaagatcgtgcggtccaagatgaacagcaccctggttggggtgttc
accatcaccctggtgttcctggcggcttttgtcaacatgttcacgtgcaactccagggac
ctgctgggctgcttggcacaggagcacaacatcagcgcgagccaggtcaacgcgtgtcac
gtggcggagtcggccgtcaactacagcctgggcgatgagcagggcttctgtggcagcccc
tggcccaactgcaacttccccgagtacttcacctacagcgtgctgctcagcctgctggcc
tgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgag
ctcatctacgtgctcatcgtggaggtgccaggtgtcacgctcttcgacaacgccgacctg
ctggtcaccgccaacgccatagacttcttcaacaacgggacctcccagtgccctgagcat
gcaaccaaggtggcattgaaggtggtgacgcccatcatcatctcagtctttgtgctggcc
ctgtacctgcacgcccagcaggtggagtccactgcccgcctcgacttcctctggaaactg
caggccacagaggagaaagaggagatggaggagctgcaggcctacaaccggcggctgctg
cacaacatcctgcccaaggacgtggccgctcacttcctggcccgcgagcggcgcaatgat
gagctctactatcagtcctgtgagtgtgtggcggtcatgttcgcctccatcgccaacttc
tccgagttctacgttgagctggaggccaacaacgagggtgtcgagtgcctgcggctactc
aatgagatcatcgctgactttgatgagatcatcagcgaggatcggttccggcagctggag
aagatcaagaccatcggcagcacctacatggctgcctccggcctcaacgactctacctac
gacaaggtgggcaagacccacatcaaggcactggccgactttgccatgaagctgatggac
cagatgaagtacatcaatgagcactccttcaacaacttccagatgaagatcgggctcaac
atcggccccgtggtggccggggtgataggggcacgaaagcctcagtacgacatctggggc
aataccgtgaacgtggccagccgcatggacagcaccggtgtacccgaccgcatccaggtc
accacagacatgtaccaggtgctggctgccaacacgtaccagctggagtgccggggcgtg
gtcaaggtcaagggcaaaggcgagatgatgacctacttcctcaatggagggcccccgctc
agttag

KEGG   Homo sapiens (human): 112Help
Entry
112               CDS       T01001                                 

Gene name
ADCY6, AC6, LCCS8
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Disease
H00865  Lethal congenital contractural syndrome
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112 (ADCY6)
   04371 Apelin signaling pathway
    112 (ADCY6)
   04072 Phospholipase D signaling pathway
    112 (ADCY6)
   04024 cAMP signaling pathway
    112 (ADCY6)
   04022 cGMP-PKG signaling pathway
    112 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112 (ADCY6)
   04062 Chemokine signaling pathway
    112 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    112 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    112 (ADCY6)
   04912 GnRH signaling pathway
    112 (ADCY6)
   04913 Ovarian steroidogenesis
    112 (ADCY6)
   04915 Estrogen signaling pathway
    112 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    112 (ADCY6)
   04921 Oxytocin signaling pathway
    112 (ADCY6)
   04926 Relaxin signaling pathway
    112 (ADCY6)
   04918 Thyroid hormone synthesis
    112 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    112 (ADCY6)
   04916 Melanogenesis
    112 (ADCY6)
   04924 Renin secretion
    112 (ADCY6)
   04925 Aldosterone synthesis and secretion
    112 (ADCY6)
   04927 Cortisol synthesis and secretion
    112 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112 (ADCY6)
   04270 Vascular smooth muscle contraction
    112 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    112 (ADCY6)
   04971 Gastric acid secretion
    112 (ADCY6)
   04972 Pancreatic secretion
    112 (ADCY6)
   04976 Bile secretion
    112 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    112 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    112 (ADCY6)
   04727 GABAergic synapse
    112 (ADCY6)
   04725 Cholinergic synapse
    112 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    112 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    112 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    112 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    112 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    112 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112 (ADCY6)
   04714 Thermogenesis
    112 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    112 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    112 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112 (ADCY6)
   05163 Human cytomegalovirus infection
    112 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112 (ADCY6)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     112 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa
Motif
Other DBs
NCBI-GeneID: 112
NCBI-ProteinID: NP_056085
OMIM: 600294
HGNC: 237
Ensembl: ENSG00000174233
Vega: OTTHUMG00000170396
Pharos: O43306(Tbio)
UniProt: O43306
LinkDB All DBs
Position
12q13.12
AA seq 1168 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY
VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICAVYSC
GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLT
PADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLA
MIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcgcggcgccgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacccctgcgggcccc
cctcggtgcccctggcaggatgacgccttcatccggaggggcggcccaggcaagggcaag
gagctggggctgcgggcagtggccctgggcttcgaggataccgaggtgacaacgacagcg
ggcgggacggctgaggtggcgcccgacgcggtgcccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacagcggtgctgctggctttccacgccgcacccgcccgccctcagcctgcctat
gtggcactgttggcctgtgccgccgccctgttcgtggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgctctcgcagcagacccgcgcagcccctctgcgggcctctgg
tgccctgtgttctttgtctacatcgcctacacgctcctccccatccgcatgcgggctgcc
gtcctcagcggcctgggcctctccaccttgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctctggaagcagctcggtgccaatgtgctgctgttcctctgcaccaac
gtcattggcatctgcacacactatccagcagaggtgtctcagcgccaggcctttcaggag
acccgcggttacatccaggcccggctccacctgcagcatgagaatcggcagcaggagcgg
ctgctgctgtcggtattgccccagcacgttgccatggagatgaaagaagacatcaacaca
aaaaaagaagacatgatgttccacaagatctacatacagaagcatgacaatgtcagcatc
ctgtttgcagacattgagggcttcaccagcctggcatcccagtgcactgcgcaggagctg
gtcatgaccctgaatgagctctttgcccggtttgacaagctggctgcggagaatcactgc
ctgaggatcaagatcttgggggactgttactactgtgtgtcagggctgccggaggcccgg
gccgaccatgcccactgctgtgtggagatgggggtagacatgattgaggccatctcgctg
gtacgtgaggtgacaggtgtgaatgtgaacatgcgcgtgggcatccacagcgggcgcgtg
cactgcggcgtccttggcttgcggaaatggcagttcgatgtgtggtccaatgatgtgacc
ctggccaaccacatggaggcaggaggccgggctggccgcatccacatcactcgggcaaca
ctgcagtacctgaacggggactacgaggtggagccaggccgtggtggcgagcgcaacgcg
tacctcaaggagcagcacattgagactttcctcatcctgggcgccagccagaaacggaaa
gaggagaaggccatgctggccaagctgcagcggactcgggccaactccatggaagggctg
atgccgcgctgggttcctgatcgtgccttctcccggaccaaggactccaaggccttccgc
cagatgggcattgatgattccagcaaagacaaccggggcacccaagatgccctgaaccct
gaggatgaggtggatgagttcctgagccgtgccatcgatgcccgcagcattgatcagctg
cggaaggaccatgtgcgccggtttctgctcaccttccagagagaggatcttgagaagaag
tactcccggaaggtggatccccgcttcggagcctacgttgcctgtgccctgttggtcttc
tgcttcatctgcttcatccagcttctcatcttcccacactccaccctgatgcttgggatc
tatgccagcatcttcctgctgctgctaatcaccgtgctgatctgtgctgtgtactcctgt
ggttctctgttccctaaggccctgcaacgtctgtcccgcagcattgtccgctcacgggca
catagcaccgcagttggcatcttttccgtcctgcttgtgtttacttctgccattgccaac
atgttcacctgtaaccacacccccatacggagctgtgcagcccggatgctgaatttaaca
cctgctgacatcactgcctgccacctgcagcagctcaattactctctgggcctggatgct
cccctgtgtgagggcaccatgcccacctgcagctttcctgagtacttcatcgggaacatg
ctgctgagtctcttggccagctctgtcttcctgcacatcagcagcatcgggaagttggcc
atgatctttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagccacc
atctttgacaactatgacctactgcttggcgtccatggcttggcttcttccaatgagacc
tttgatgggctggactgtccagctgcagggagggtggccctcaaatatatgacccctgtg
attctgctggtgtttgcgctggcgctgtatctgcatgctcagcaggtggagtcgactgcc
cgcctagacttcctctggaaactacaggcaacaggggagaaggaggagatggaggagcta
caggcatacaaccggaggctgctgcataacattctgcccaaggacgtggcggcccacttc
ctggcccgggagcgccgcaatgatgaactctactatcagtcgtgtgagtgtgtggctgtt
atgtttgcctccattgccaacttctctgagttctatgtggagctggaggcaaacaatgag
ggtgtcgagtgcctgcggctgctcaacgagatcatcgctgactttgatgagattatcagc
gaggagcggttccggcagctggaaaagatcaagacgattggtagcacctacatggctgcc
tcagggctgaacgccagcacctacgatcaggtgggccgctcccacatcactgccctggct
gactacgccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaat
ttccagatgaagattgggctgaacatgggcccagtcgtggcaggtgtcatcggggctcgg
aagccacagtatgacatctgggggaacacagtgaatgtctctagtcgtatggacagcacg
ggggtccccgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaagggc
taccagctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctac
ttcctcaatgggggccccagcagttaa

KEGG   Homo sapiens (human): 113Help
Entry
113               CDS       T01001                                 

Gene name
ADCY7, AC7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113 (ADCY7)
   04371 Apelin signaling pathway
    113 (ADCY7)
   04020 Calcium signaling pathway
    113 (ADCY7)
   04072 Phospholipase D signaling pathway
    113 (ADCY7)
   04024 cAMP signaling pathway
    113 (ADCY7)
   04022 cGMP-PKG signaling pathway
    113 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113 (ADCY7)
   04062 Chemokine signaling pathway
    113 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    113 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    113 (ADCY7)
   04912 GnRH signaling pathway
    113 (ADCY7)
   04913 Ovarian steroidogenesis
    113 (ADCY7)
   04915 Estrogen signaling pathway
    113 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    113 (ADCY7)
   04921 Oxytocin signaling pathway
    113 (ADCY7)
   04926 Relaxin signaling pathway
    113 (ADCY7)
   04918 Thyroid hormone synthesis
    113 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    113 (ADCY7)
   04916 Melanogenesis
    113 (ADCY7)
   04925 Aldosterone synthesis and secretion
    113 (ADCY7)
   04927 Cortisol synthesis and secretion
    113 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113 (ADCY7)
   04270 Vascular smooth muscle contraction
    113 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    113 (ADCY7)
   04971 Gastric acid secretion
    113 (ADCY7)
   04972 Pancreatic secretion
    113 (ADCY7)
   04976 Bile secretion
    113 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    113 (ADCY7)
   04727 GABAergic synapse
    113 (ADCY7)
   04725 Cholinergic synapse
    113 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    113 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    113 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    113 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113 (ADCY7)
   04714 Thermogenesis
    113 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    113 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    113 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113 (ADCY7)
   05163 Human cytomegalovirus infection
    113 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113 (ADCY7)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113 (ADCY7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Motif
Other DBs
NCBI-GeneID: 113
NCBI-ProteinID: NP_001105
OMIM: 600385
HGNC: 238
Ensembl: ENSG00000121281
Vega: OTTHUMG00000133172
Pharos: P51828(Tbio)
UniProt: P51828 Q86YI0
LinkDB All DBs
Position
16q12.1
AA seq 1080 aa AA seqDB search
MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPS
RHQAILGMAFLVLAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAA
CAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQ
VREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
SLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISER
VETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVGNETGLLAASSKTRALCEPLP
YYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCCGQGLGNLTKP
NGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAH
IGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctcaacgagggcgaggagggccctgaccaagatgcg
ctctacgagaagtaccagctcaccagccagcatgggccgctgctgctcacgctcctgctg
gtggccgccactgcctgcgtggccctcatcatcattgccttcagccagggggacccctcc
agacaccaggccattctgggcatggcgttcctggtgctggcggtgtttgcggccctctct
gtgctgatgtacgtcgagtgtctcctgcggcgctggctcagggccttggcgctgctcacc
tgggcctgcttggtggcgctgggctatgtgctggtgttcgacgcatggacaaaggcggcc
tgtgcgtgggagcaggtgcccttcttcctgttcattgtcttcgtggtgtacacactactg
cccttcagcatgcggggcgctgtcgccgttggggccgtctccactgcctcccacctcctg
gtgctcggttctttgatgggaggcttcacgacacccagtgtccgggtggggctgcagctg
ctggccaacgcagtcatcttcctgtgtgggaacctgacaggcgccttccacaagcaccaa
atgcaggatgcgtcccgggacctcttcacctacactgtgaagtgcatccagatccgccgg
aagctgcgcatcgagaagcgccagcaggagaacctgctgctgtcagtgcttccggcccac
atctccatgggcatgaagctggccatcatcgaacggctcaaggagcatggtgaccgtcgc
tgcatgcctgacaacaacttccacagcctctacgtcaagaggcaccagaatgtcagcatc
ctctatgcggacatcgtgggcttcacgcagctggccagcgactgttctcccaaggagctg
gtggtggtgctgaatgagctctttggcaagttcgaccagatcgccaaggccaacgagtgc
atgcgaatcaagatcctcggcgactgctactactgtgtatcgggcctgcccgtgtcgctg
cctacccacgcccggaactgcgtgaagatggggctggacatgtgccaggccatcaagcag
gtgcgggaggccacgggcgtggacatcaacatgcgtgtgggcatacactcggggaatgtg
ctgtgcggggtcatcgggctgcgcaagtggcagtatgacgtgtggtcccacgacgtgtcc
ctggccaaccggatggaggcagccggagtacccggccgggtgcacatcacggaggccacg
ctaaagcacctggacaaggcgtacgaggtggaggatgggcacgggcagcagcgggacccc
tacctcaaggagatgaacatccgcacctacctggtcatcgacccccggagccagcagcca
cccccgcccagccaacacctccccaggcccaagggggacgcggccctgaagatgcgggcg
tcagtgcgcatgacccggtacctcgagtcctggggggcggcacggccctttgcacatctc
aaccaccgtgagagcgtgagcagtggtgagacccacgtccccaacgggcggaggcctaag
agcgttccccagcgccaccgccggaccccagacagaagcatgtcccccaaggggcggtcg
gaggatgactcgtacgatgacgagatgctgtcagccattgaggggctcagctccacgagg
ccctgctgctccaagtccgatgacttctacacctttgggtccatcttcctggagaagggc
tttgagcgcgagtaccgcctggcacccatcccccgggcccgccacgactttgcctgcgcc
agcctgatcttcgtctgcatcctgctcgtccatgtcctgctcatgcccaggacggcggca
ctgggtgtgtccttcgggctggtggcctgtgtactggggctggtgctgggcctgtgcttt
gccaccaagttctcgaggtgctgcccagctcgggggacgctctgcactatctctgagagg
gtggagacacagcccctgctgaggctgaccctggccgtcctgaccatcggcagcctgctc
actgtggccatcatcaacctgcccctgatgcctttccaagttccagagctgcctgttggc
aatgagacaggcctactggccgcgagcagcaagacaagagccctgtgtgagcccctcccg
tactacacctgcagctgtgtcctgggcttcatcgcctgctcggtcttcctgaggatgagc
ctggagccaaaggttgtgctgctgacagtggccctggtggcctacctggtgctcttcaac
ctctccccatgctggcagtgggactgctgcggccaaggcctgggcaacctcaccaagccc
aacggcaccaccagtggcacccctagctgttcctggaaggacctgaagaccatgaccaat
ttctacctggtcctgttctacatcaccctgcttacactctccagacagattgactattac
tgccgcttggactgcctatggaagaagaagttcaagaaggagcacgaggagtttgagacc
atggagaacgtgaaccgccttcttctggagaacgtcctgccagcccacgtggctgcccac
tttatcggtgacaagttaaacgaggactggtaccatcagtcctatgactgcgtctgtgtc
atgtttgcctccgtgccggacttcaaagtgttctacacagagtgcgatgtcaacaaagaa
gggctggagtgcctacgcctgctcaatgagatcattgccgacttcgacgagctcctactg
aagcccaagttcagcggcgtggagaagatcaagaccatcggcagcacgtacatggcagct
gcagggctcagcgtcgcctcagggcacgagaaccaggagctggagcggcagcatgcccac
attggtgtcatggtggagttcagcatcgccctgatgagtaagctggacggcatcaacagg
cactccttcaactccttccgcctccgcgtcggcataaaccatgggcctgtgattgctgga
gtgattggggcccgaaaacctcagtatgacatctggggaaacactgtcaatgtggccagc
cgaatggaaagcactggagaacttgggaaaatccaggttaccgaggagacctgcaccatc
ctccagggcctcgggtactcttgtgaatgccgtggcctgatcaacgtcaaaggcaaaggc
gagctgaggacttactttgtctgtacggacactgccaagtttcaggggctggggctgaac
tga

KEGG   Homo sapiens (human): 114Help
Entry
114               CDS       T01001                                 

Gene name
ADCY8, AC8, ADCY3, HBAC1
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    114 (ADCY8)
   04371 Apelin signaling pathway
    114 (ADCY8)
   04020 Calcium signaling pathway
    114 (ADCY8)
   04072 Phospholipase D signaling pathway
    114 (ADCY8)
   04024 cAMP signaling pathway
    114 (ADCY8)
   04022 cGMP-PKG signaling pathway
    114 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    114 (ADCY8)
   04062 Chemokine signaling pathway
    114 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    114 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    114 (ADCY8)
   04912 GnRH signaling pathway
    114 (ADCY8)
   04913 Ovarian steroidogenesis
    114 (ADCY8)
   04915 Estrogen signaling pathway
    114 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    114 (ADCY8)
   04921 Oxytocin signaling pathway
    114 (ADCY8)
   04926 Relaxin signaling pathway
    114 (ADCY8)
   04918 Thyroid hormone synthesis
    114 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    114 (ADCY8)
   04916 Melanogenesis
    114 (ADCY8)
   04925 Aldosterone synthesis and secretion
    114 (ADCY8)
   04927 Cortisol synthesis and secretion
    114 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114 (ADCY8)
   04270 Vascular smooth muscle contraction
    114 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    114 (ADCY8)
   04971 Gastric acid secretion
    114 (ADCY8)
   04972 Pancreatic secretion
    114 (ADCY8)
   04976 Bile secretion
    114 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    114 (ADCY8)
   04727 GABAergic synapse
    114 (ADCY8)
   04725 Cholinergic synapse
    114 (ADCY8)
   04720 Long-term potentiation
    114 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    114 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    114 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    114 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    114 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    114 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    114 (ADCY8)
   04714 Thermogenesis
    114 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    114 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    114 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114 (ADCY8)
   05163 Human cytomegalovirus infection
    114 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    114 (ADCY8)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     114 (ADCY8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 114
NCBI-ProteinID: NP_001106
OMIM: 103070
HGNC: 239
Ensembl: ENSG00000155897
Vega: OTTHUMG00000164756
Pharos: P40145(Tbio)
UniProt: P40145 A0A0K0K1K3 Q4F7X0
LinkDB All DBs
Position
8q24.22
AA seq 1251 aa AA seqDB search
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGS
GSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEV
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP
NT seq 3756 nt NT seq  +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttacaggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcaggagcgcctcccggccgcagcggctgctgtggcagacg
gcggtgcgacacatcacggagcagcgcttcattcacgggcaccggggaggcagcggcagc
gggagtggaggctcgggcaaagcctcggaccctgcgggcggcggccccaaccaccacgcg
ccgcagctgtcaggcgactcggcgctgcccctctactcgctgggcccgggagagcgagcg
cacagcacctgcggcaccaaagtcttcccggaacgcagcgggagcggcagtgccagcggc
agcggaggcgggggcgacctgggcttcctgcaccttgactgtgcccctagcaactcggat
ttctttcttaatgggggctatagctaccgaggggtcattttccccaccctgcgcaactcc
ttcaaatctcgggatttggaacgcctctaccagcgctatttcttgggccaaaggcgcaaa
tcggaagtggtgatgaacgtgctggacgtgctgaccaaactcactctcttggtcctacac
ttgagcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttcttcacc
ggcattgaggtagtgatctgcgccctggtggtggtcaggaaggacaccacctcccacacg
tacctgcagtacagcggcgtggtcacctgggtggccatgaccacccagatcctggcagca
ggcctcggctacgggctcctgggcgacggcataggctacgtgctcttcacgctcttcgcc
acctacagtatgctgccgctgccgctcacctgggccatcctggccggcctgggcacctcg
ctgctgcaggtcatcctccaagtggtcataccccggctggcggtcatttccatcaaccag
gttgtggcccaggcagtgctattcatgtgtatgaacacagctggaatcttcatcagttac
ctgtcagaccgggcccagcgccaagctttcctggagactcggaggtgtgtggaggccagg
ctgcgcctggagacagagaaccaaagacaggagcggctcgtgctttctgtgctcccccgg
tttgttgtcctggaaatgatcaacgacatgaccaatgtggaagatgagcacctgcagcac
cagttccatcggatctacatccatcgctatgagaacgtcagtattctttttgcagatgtt
aaaggatttaccaacctctccacgaccttgtctgctcaggagctggtcaggatgctcaac
gagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtattaaaatc
ctgggggactgctactactgcgtgtctggacttcctgagccccgccaggaccatgcccac
tgctgtgttgaaatgggtctcagcatgatcaaaaccatcaggtatgtgcggtcaaggaca
aaacacgatgttgacatgaggattggaatccactccggctcggtgctgtgcggtgttttg
ggactaaggaagtggcagtttgatgtctggtcttgggatgtggatattgcaaacaaactc
gaatctggaggaatccctgggaggattcacatttccaaagccacgctggactgtctcaac
ggtgactataacgtggaagagggccatggtaaagagaggaatgaattcctgaggaagcat
aatatcgaaacttacttaattaagcagcctgaggacagtctgctgtccttgcctgaagat
atcgtcaaggagtcagtgagctcctcagaccggagaaacagtggggccacattcactgaa
ggatcctggagccctgaactgccctttgataatatcgtggggaaacagaatactctggct
gccctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggc
gataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggatgaagtgttcaagtcaaacttggtctgtgcattt
atcgttcttctatttatcacggcaatacaaagtttgcttccttcttcaagagtgatgcca
atgaccatccagttctccattctgattatgctgcactcggctctggtcctcatcaccaca
gcagaggattataaatgtttgcccctcatcctccggaaaacttgctgttggattaatgag
acctatttggcccggaacgtcatcatctttgcatccattttgattaatttcctgggtgcc
atcttaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcacgggg
gtgttggccatggtgacctgtgcagttttcctccggctgaactccgtcctgaagctggca
gtgctgctgatcatgattgccatctatgccctgctcactgagaccgtctacgcaggcctc
tttctgcgttatgacaacctcaaccacagtggagaagatttcctggggaccaaggaggta
tcactgctactgatggccatgttcctcctggctgtgttctaccatggacagcagctggag
tacacagcccgcctggacttcctttggcgagtacaggccaaagaggagatcaatgagatg
aaggagctgagggaacacaatgagaacatgctccggaatatcttacccagccatgtggcc
cgccatttcctagagaaggaccgagacaatgaggagctgtattctcaatcctatgatgct
gttggggtgatgtttgcctccatcccaggatttgcggacttttactctcagactgaaatg
aataaccagggagtggaatgcctgcgcttgctcaatgagatcattgctgacttcgatgag
ttgcttggtgaagaccgatttcaagacattgaaaagattaagaccattggcagcacctac
atggccgtgtcaggcctgtcacctgaaaaacagcaatgtgaagacaagtggggacatttg
tgtgctctggctgacttctcactcgccctgacagaaagcatacaggagatcaacaagcat
tcattcaacaattttgaactccggattggcatcagccacggctcagtggtagctggcgtt
atcggcgctaagaaaccacagtatgacatttggggcaaaactgtgaacctggcaagccga
atggacagcacgggggttagtggccggatccaagtcccagaggagacctatctcatcctg
aaggaccagggctttgcctttgattaccgaggggagatctatgtgaagggtatcagtgaa
caggaaggaaaaatcaaaacgtactttcttctgggaagagtccaacccaacccattcatc
ttgcccccaagaagactgcctgggcagtactccctggccgcggttgtcctgggacttgtc
cagtccctcaataggcaaaggcagaagcagctactcaatgagaacaacaacacaggaatc
atcaagggtcattacaaccggcggactttgttgtcacccagcggcacagagcctggagcc
caggctgaaggcaccgacaaatctgatttgccataa

KEGG   Homo sapiens (human): 115Help
Entry
115               CDS       T01001                                 

Gene name
ADCY9, AC9, ACIX
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05110  Vibrio cholerae infection
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    115 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    115 (ADCY9)
   04371 Apelin signaling pathway
    115 (ADCY9)
   04020 Calcium signaling pathway
    115 (ADCY9)
   04072 Phospholipase D signaling pathway
    115 (ADCY9)
   04024 cAMP signaling pathway
    115 (ADCY9)
   04022 cGMP-PKG signaling pathway
    115 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    115 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    115 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    115 (ADCY9)
   04062 Chemokine signaling pathway
    115 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    115 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    115 (ADCY9)
   04912 GnRH signaling pathway
    115 (ADCY9)
   04913 Ovarian steroidogenesis
    115 (ADCY9)
   04915 Estrogen signaling pathway
    115 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    115 (ADCY9)
   04921 Oxytocin signaling pathway
    115 (ADCY9)
   04926 Relaxin signaling pathway
    115 (ADCY9)
   04918 Thyroid hormone synthesis
    115 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    115 (ADCY9)
   04916 Melanogenesis
    115 (ADCY9)
   04925 Aldosterone synthesis and secretion
    115 (ADCY9)
   04927 Cortisol synthesis and secretion
    115 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    115 (ADCY9)
   04270 Vascular smooth muscle contraction
    115 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    115 (ADCY9)
   04971 Gastric acid secretion
    115 (ADCY9)
   04972 Pancreatic secretion
    115 (ADCY9)
   04976 Bile secretion
    115 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    115 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    115 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    115 (ADCY9)
   04727 GABAergic synapse
    115 (ADCY9)
   04725 Cholinergic synapse
    115 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    115 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    115 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    115 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    115 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    115 (ADCY9)
   04714 Thermogenesis
    115 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    115 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    115 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    115 (ADCY9)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    115 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    115 (ADCY9)
   05163 Human cytomegalovirus infection
    115 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    115 (ADCY9)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     115 (ADCY9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 DUF512 zf-C2HC_2 AC_N
Motif
Other DBs
NCBI-GeneID: 115
NCBI-ProteinID: NP_001107
OMIM: 603302
HGNC: 240
Ensembl: ENSG00000162104
Vega: OTTHUMG00000177612
Pharos: O60503(Tbio)
UniProt: O60503
LinkDB All DBs
Position
16p13.3
AA seq 1353 aa AA seqDB search
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRGLLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSEYETNIHFPVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVLTSPLDAVQNFSSER
NPCNSSVPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHRVIPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQAKDAHLSPKRPWKEPVKAEE
RGRFGKAIEKDDCDETGIEEANELTKLNVSKSV
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccaccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaaatacagcatctcctctagctgcagcagctctggggactcc
gggggcgtcccccggcgagtgggcggcggaggccggctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtgaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccggttccggtatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttgcggtccacatgagatcc
agactgatcgtcatggtcgcccccgcgctgtgcttcctcctggtgtgtgtgggcttcttt
ctgtttaccttcaccaagctgtacgcccggcattacgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagttccaggtcttgacgcctgtctcagga
cgcggcgacagctccaaccttacggccacagcccggcccacagatacttgcttatctcaa
gtggggagcttctccatgtgcatcgaagtgctctttttgctctataccgtcatgcactta
cctttgtacctgagtttgtgtctgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagccggggccctgcactgggag
ctgctgagcagggggctgctccacggctgcatccacgccatcggggtccacctgttcgtc
atgtcccaggtgaggtccaggagcaccttcctcaaggtggggcaatccattatgcacggg
aaggacctggaagtggaaaaagccctcaaagagaggatgattcattccgtgatgccaaga
atcatagccgatgacttaatgaagcagggagatgaggagagtgagaattctgtcaagagg
catgccacctcgagccccaagaacaggaagaaaaagtcttccatccaaaaagctcctata
gccttccgcccttttaagatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtctgcccacgccctggtgggtctcctgaac
gatctgttcggtcgcttcgaccgcctgtgtgaggagaccaagtgtgagaaaatcagcacc
ctgggagactgttactactgcgtggcgggctgtcccgagccccgggccgaccatgcctac
tgctgcatcgagatgggcctgggcatgatcaaggccatcgagcagttctgccaggagaag
aaggagatggtgaacatgagagtcggggtgcacacgggcaccgtcctttgcggcatcctg
ggcatgaggaggtttaaatttgacgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggagtggccggcaaagttcacatttctgaggccaccgcaaaatacttagat
gaccggtacgaaatggaagatgggaaagttattgaacggctgggccagagcgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcgc
tgcagctgtgcagaggccttgctttctggctttgaggtcattgacggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcgtgcggaatcacatttgctcccaaa
tctgaagccggcgccgagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggcttctggaggacctaatcccaaaactcagaacgggctcctcagccctccc
caagaggagaagctcaccaacagtcagacttctctgtgtgagatcttgcaggagaaggga
aggtgggcaggggtgagcctggaccagtcggctctccttccgctgaggttcaagaacatc
cgggagaaaacggacgcccactttgtggacgttatcaaagaagacagcctgatgaaagat
tacttttttaagccgcccattaatcagttcagcctgaacttcctggatcaggagctggag
cgatcctacaggaccagctatcaggaagaggtcataaagaactcccccgtgaagacgttt
gctagtcccaccttcagctccctcctggatgtgtttctgtcgaccacagtgtttctgacg
ctgtccaccacctgcttcctgaagtacgaggcggccaccgtgcctcccccgcccgccgcc
ctggcggtcttcagtgcagccctgctgctggaggtgctgtccctcgcggtgtccatcagg
atggtgttcttcctggaggacgtcatggcctgcaccaagcgcctgctggagtggatcgcc
ggctggctaccacgtcactgcatcggggccatcctggtgtcgcttcccgcactggccgtc
tactcccatgtcacctccgaatatgagaccaacatacacttcccagtgttcacaggctcg
gccgcgctgattgccgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccctcgccaccgtcgtgggggccgggccgctgctcctgctctacgtctccctgtgc
ccagacagttctgtattaacttcgccccttgacgcagtacagaatttcagttccgagagg
aacccgtgcaatagttcggtgccgcgtgacctccggcggcccgccagcctcatcggccag
gaggtggttctcgtcttctttctcctgctcttgttggtctggttcctgaatcgcgaattt
gaagtcagctaccgcctccactaccacggagacgtggaagcggatcttcaccgcaccaag
atccagagcatgcgggaccaggcagactggctgctgaggaacatcatcccctaccacgtg
gctgagcagctgaaggtgtcccagacctactccaagaaccatgacagcggaggggtgatc
ttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaaggag
tgctaccgggtcctcaacgagctcatcggggactttgacgagctcctaagcaagccggac
tacagcagcatcgagaagatcaagaccatcggagccacgtacatggcggcgtcagggctg
aacaccgcgcaggcccaggacggcagccacccgcaggagcacctgcagatcctgttcgag
ttcgccaaggagatgatgcgcgtggtggacgacttcaacaacaacatgctgtggttcaac
ttcaagctccgcgtcggcttcaaccatgggcccctcacggccggggtcatcggcaccacc
aagctgctgtacgacatctggggagacaccgtcaacatcgccagcaggatggacaccacc
ggcgtggagtgccgcatccaggtgagcgaagagagctaccgcgtcttgagcaagatgggc
tatgacttcgactacagagggaccgtgaatgtcaaggggaaaggccagatgaagacctac
ctgtacccaaagtgcacggatcacagggtcatcccacagcaccagctgtccatctcccca
gacatccgcgtccaggtggatggcagcatcggacggtctcccacagacgagattgccaac
ctggtgccttctgtccagtatgtggacaagacatctctgggttctgacagcagcacgcag
gccaaggatgcccacctgtcccccaagagaccgtggaaggagcccgtcaaagccgaagaa
aggggtcgatttggcaaagccatagagaaagacgactgtgacgaaacaggaatagaagaa
gccaacgaactcaccaagctcaacgtttcaaagagtgtgtga

KEGG   Homo sapiens (human): 196883Help
Entry
196883            CDS       T01001                                 

Gene name
ADCY4, AC4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
nt06310  ACTH-cortisol signaling
nt06311  CRH-ACTH signaling
nt06317  PTH-cAMP-PKA signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    196883 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    196883 (ADCY4)
   04371 Apelin signaling pathway
    196883 (ADCY4)
   04020 Calcium signaling pathway
    196883 (ADCY4)
   04072 Phospholipase D signaling pathway
    196883 (ADCY4)
   04024 cAMP signaling pathway
    196883 (ADCY4)
   04022 cGMP-PKG signaling pathway
    196883 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    196883 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    196883 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    196883 (ADCY4)
   04062 Chemokine signaling pathway
    196883 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    196883 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    196883 (ADCY4)
   04912 GnRH signaling pathway
    196883 (ADCY4)
   04913 Ovarian steroidogenesis
    196883 (ADCY4)
   04915 Estrogen signaling pathway
    196883 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    196883 (ADCY4)
   04921 Oxytocin signaling pathway
    196883 (ADCY4)
   04926 Relaxin signaling pathway
    196883 (ADCY4)
   04918 Thyroid hormone synthesis
    196883 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    196883 (ADCY4)
   04916 Melanogenesis
    196883 (ADCY4)
   04925 Aldosterone synthesis and secretion
    196883 (ADCY4)
   04927 Cortisol synthesis and secretion
    196883 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    196883 (ADCY4)
   04270 Vascular smooth muscle contraction
    196883 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    196883 (ADCY4)
   04971 Gastric acid secretion
    196883 (ADCY4)
   04972 Pancreatic secretion
    196883 (ADCY4)
   04976 Bile secretion
    196883 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    196883 (ADCY4)
   04727 GABAergic synapse
    196883 (ADCY4)
   04725 Cholinergic synapse
    196883 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    196883 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    196883 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    196883 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    196883 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    196883 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    196883 (ADCY4)
   04714 Thermogenesis
    196883 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    196883 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    196883 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    196883 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    196883 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    196883 (ADCY4)
   05163 Human cytomegalovirus infection
    196883 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    196883 (ADCY4)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     196883 (ADCY4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Motif
Other DBs
NCBI-GeneID: 196883
NCBI-ProteinID: NP_001185497
OMIM: 600292
HGNC: 235
Ensembl: ENSG00000129467
Vega: OTTHUMG00000029347
Pharos: Q8NFM4(Tbio)
UniProt: Q8NFM4
LinkDB All DBs
Position
14q12
AA seq 1077 aa AA seqDB search
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgcagtggcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggcgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctgctggtcctcgggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaacgcagtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccctgcactcacgccggcggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcactaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctctgggctgccactctcactgccagaccatgccatcaac
tgcgtgcgcatgggcctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagcgtactgtgtggagtcatcggg
ctgcagaagtggcagtacgacgtttggtcacatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggacgcaggcatggagcatcgggacccctaccttcgggagctaggg
gagcctacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctgtcctcgcttgagggcctcaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacggagacagccct
gtgtccacctccacccctctcccggagaagaccctggcttccttcagcacccagtggagc
ctggatcggagccgtaccccccggggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcgcagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcatcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccgccaccatcctccttgtctttgccatggccattacc
agcctgttcttcttcccaacatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcatcctgctccctcttcctgcac
tcccatgcctggctgtcggaatgcctcatcgtccgcctctatctgggccccttggactcc
aggcccggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagagggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctatgaatgcgtttgtgtcctcttcgcctcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccgtggccctggggtctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgagtggggttgaaccatggacccgtagtagctggagttattggggcccag
aagccgcaatatgacatttggggcaacacagtgaacgtggccagccgcatggagagtaca
ggagtccttggcaaaatccaagtgactgaggagacagcatgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaactggacctccttcagctaccctaggctga

DBGET integrated database retrieval system