KEGG   Homo sapiens (human): 10715Help
Entry
10715             CDS       T01001                                 

Gene name
CERS1, EPM8, GDF-1, GDF1, LAG1, LASS1, UOG1
Definition
(RefSeq) ceramide synthase 1
  KO
K04710  ceramide synthetase [EC:2.3.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    10715 (CERS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    10715 (CERS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     10715 (CERS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 10715
NCBI-ProteinID: NP_067090
OMIM: 606919
HGNC: 14253
Ensembl: ENSG00000223802
Vega: OTTHUMG00000183049
Pharos: P27544(Tbio)
UniProt: P27544
LinkDB All DBs
Position
19p13.11
AA seq 350 aa AA seqDB search
MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL
LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL
FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML
LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA
DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL
YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggggcccgcggcggggccgacggggcccgagcccatgccgagctacgcg
cagctagtgcagcgcggctggggcagcgcgctggcggcggcgcggggctgcacggactgc
ggctgggggctggcgcgtcgcggcctggctgagcacgcgcacctggcgccgcccgagctg
ctgctgctggcgctcggcgcgctgggctggaccgccctgcgctccgcggccactgcgcgc
ctctttcggcccctggcgaagcggtgctgcctccagcccagagatgccgccaagatgccc
gagagcgcttggaagtttctcttctacctgggcagctggagctacagtgcctacctgctg
tttggcaccgactaccccttcttccatgacccaccatctgtcttctacgactggacgccg
ggcatggcagtgccacgggacattgcagccgcctacctgctccagggaagcttctatggc
cactccatctacgctacgctatacatggacacctggcgcaaggactcggtggtcatgctg
ctccaccacgtggtcactctcatcctcatcgtctcctcctacgccttccggtaccacaat
gtgggcatccttgtgctcttcctgcacgatatcagtgacgtgcagcttgagttcaccaag
ctcaacatttacttcaagtcccgcggcggctcctaccatcggctgcatgccttggcagca
gacttgggctgcctcagcttcggcttcagctggttctggttccgcctctactggttcccg
ctcaaggtcctgtatgccaccagtcactgcagtctgcgcacggtgcctgacatccccttc
tacttcttcttcaatgcgctcctgctgctgctcacccttatgaacctctactggttcctg
tacatcgtggcgtttgcagccaaggtgttgacaggccaggtgcacgagctgaaggacctg
cgggagtatgacacagccgaggcccagagcctgaagcccagcaaagccgagaagccactg
aggaacggcctggtgaaggacaagcgcttctga

KEGG   Homo sapiens (human): 204219Help
Entry
204219            CDS       T01001                                 

Gene name
CERS3, ARCI9, LASS3
Definition
(RefSeq) ceramide synthase 3
  KO
K04710  ceramide synthetase [EC:2.3.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Disease
H00734  Autosomal recessive congenital ichthyosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    204219 (CERS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    204219 (CERS3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     204219 (CERS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain Homez DUF1003
Motif
Other DBs
NCBI-GeneID: 204219
NCBI-ProteinID: NP_001277271
OMIM: 615276
HGNC: 23752
Ensembl: ENSG00000154227
Vega: OTTHUMG00000172568
Pharos: Q8IU89(Tbio)
UniProt: Q8IU89
LinkDB All DBs
Position
15q26.3
AA seq 383 aa AA seqDB search
MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFV
ASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSR
RNQERPSRLKKFQEACWRFAFYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYW
YYILEMSFYWSLLFRLGFDVKRKDFLAHIIHHLAAISLMSFSWCANYIRSGTLVMIVHDV
ADIWLESAKMFSYAGWTQTCNTLFFIFSTIFFISRLIVFPFWILYCTLILPMYHLEPFFS
YIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGK
EMDCLKNGLRAERHLIPNGQHGH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgttttggacgtttaaagaatggttctggttggaaagattctggcttcctccaacaata
aagtggtcagatcttgaggatcacgatggactcgtctttgtaaaaccttctcatttatac
gtgacaattccatatgcttttctcttgctgattatcagacgtgtatttgaaaaatttgtt
gcttcacctctagcaaaatcatttggcattaaagagacagttcgaaaggttacaccaaat
actgtcttagagaattttttcaaacattccacaaggcaaccattgcaaactgatatttat
ggactggcaaagaagtgtaacttgacggagcgccaggtggaaagatggtttaggagtcgg
cggaatcaagagaggccttccaggctgaagaaattccaggaagcttgctggagatttgca
ttttacttaatgatcactgttgctggaattgcgtttctttatgataaaccttggctatat
gacttatgggaggtttggaatggctatcccaaacagcccctgctgccatcccagtactgg
tactacattttagaaatgagtttttattggtctctgttatttagacttggctttgatgtc
aagagaaaggattttctagctcatatcatccaccacctggctgctattagtctgatgagc
ttctcttggtgtgctaattatattcgcagtgggaccctcgtgatgattgtacacgatgtg
gctgacatttggctggagtctgctaagatgttttcttatgctggatggacgcagacctgt
aacaccctgtttttcatcttctccaccatatttttcatcagccgcctcattgtttttcct
ttctggattttatattgcacgctgatcttgcctatgtatcacctcgagcctttcttttca
tacatcttcctcaacctacagctcatgatcttgcaggtccttcacctttactggggttat
tacatcttgaagatgctcaacagatgtatattcatgaagagcatccaggatgtgaggagt
gatgacgaggattatgaagaggaagaggaagaggaagaagaagaggctaccaaaggcaaa
gagatggattgtttaaagaacggcctcagggctgagaggcacctcattcccaatggccag
catggccattag

KEGG   Homo sapiens (human): 253782Help
Entry
253782            CDS       T01001                                 

Gene name
CERS6, CERS5, LASS6
Definition
(RefSeq) ceramide synthase 6
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    253782 (CERS6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    253782 (CERS6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     253782 (CERS6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Motif
Other DBs
NCBI-GeneID: 253782
NCBI-ProteinID: NP_982288
OMIM: 615336
HGNC: 23826
Ensembl: ENSG00000172292
Vega: OTTHUMG00000132183
Pharos: Q6ZMG9(Tbio)
UniProt: Q6ZMG9
LinkDB All DBs
Position
2q24.3
AA seq 384 aa AA seqDB search
MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFVA
KPCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR
RNQEKPSTLTRFCESMWRFSFYLYVFTYGVRFLKKTPWLWNTRHCWYNYPYQPLTTDLHY
YYILELSFYWSLMFSQFTDIKRKDFGIMFLHHLVSIFLITFSYVNNMARVGTLVLCLHDS
ADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVGPYPS
WWVFNLLLLLVQGLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEEDSEPPGKNPH
TATTTNGTSGTNGYLLTGSCSMDD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcagggatcttagcctggttctggaacgagaggttttggctcccgcacaatgtcacc
tgggcggacctgaagaacacggaggaggccaccttcccgcaggctgaggacctctatctc
gcttttcccctggccttctgtatcttcatggtgcggctcatcttcgagagatttgtagcc
aaaccgtgcgccatagccctcaacattcaggccaatggaccacaaattgctccgcccaat
gccattctggaaaaggtcttcactgcaattacaaagcatcctgatgaaaagagattggaa
ggcctctccaagcaactggactgggatgttcgaagcattcagcgctggtttcgacaaaga
cgcaatcaggagaagccaagcacgctgacgaggttctgtgagagcatgtggagattttca
ttttacctttatgtatttacctacggagtcagattcctgaaaaagaccccctggttgtgg
aatacgaggcattgctggtacaactacccctatcagccactcacaactgaccttcactac
tattacatcctggagctgtcgttttattggtctttgatgttttctcagttcactgatatc
aaaagaaaggactttggcattatgttcctgcaccaccttgtatctattttcttgattacc
ttttcatatgtcaacaatatggcccgagtaggaacgctggtcctttgtcttcatgattca
gctgatgctcttctggaggctgccaaaatggcaaattatgccaagtttcagaaaatgtgt
gatctcctgtttgttatgtttgccgtggtttttatcaccacacgactgggtatatttcct
ctctgggtgttaaataccacattatttgaaagctgggagatcgttggaccttacccttcc
tggtgggtttttaacctactgctattgctagtacaagggttgaactgcttctggtcttac
ttgattgtgaaaatagcttgcaaagctgtttcaagaggcaaggtgtccaaggatgatcga
agtgatattgagtctagctcagatgaggaggactcagaacctccgggaaagaatccccac
actgcgacaaccaccaatgggaccagtggtaccaacgggtatctcctgactggctcctgc
tccatggatgattaa

KEGG   Homo sapiens (human): 29956Help
Entry
29956             CDS       T01001                                 

Gene name
CERS2, L3, LASS2, SP260, TMSG1
Definition
(RefSeq) ceramide synthase 2
  KO
K04710  ceramide synthetase [EC:2.3.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    29956 (CERS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    29956 (CERS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     29956 (CERS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain Homez TRAM1
Motif
Other DBs
NCBI-GeneID: 29956
NCBI-ProteinID: NP_071358
OMIM: 606920
HGNC: 14076
Ensembl: ENSG00000143418
Vega: OTTHUMG00000035064
Pharos: Q96G23(Tbio)
UniProt: Q96G23
LinkDB All DBs
Position
1q21.3
AA seq 380 aa AA seqDB search
MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV
ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR
RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY
WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD
SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF
GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA
KSRPLANGHPILNNNHRKND
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaccttgtatgattacttctggtgggaacgtctgtggctgcctgtgaacttg
acctgggccgatctagaagaccgagatggacgtgtctacgccaaagcctcagatctctat
atcacgctgcccctggccttgctcttcctcatcgttcgatacttctttgagctgtacgtg
gctacaccactggctgccctcttgaacataaaggagaaaactcggctgcgggcacctccc
aacgccaccttggaacatttctacctgaccagtggcaagcagcccaagcaggtggaagta
gagcttttgtcccggcagagcgggctctctggccgccaggtagagcgttggttccgtcgc
cgccgcaaccaggaccggcccagtctcctcaagaagttccgagaagccagctggagattc
acattttacctgattgccttcattgccggcatggccgtcattgtggataaaccctggttc
tatgacatgaagaaagtttgggagggatatcccatacagagcactatcccttcccagtat
tggtactacatgattgaactttccttctactggtccctgctcttcagcattgcctctgat
gtcaagcgaaaggatttcaaggaacagatcatccaccatgtggccaccatcattctcatc
agcttttcctggtttgccaattacatccgagctgggactctaatcatggctctgcatgac
tcttccgattacctgctggagtcagccaagatgtttaactacgcgggatggaagaacacc
tgcaacaacatcttcatcgtcttcgccattgtttttatcatcacccgactggtcatcctg
cccttctggatcctgcattgcaccctggtgtacccactggagctctatcctgccttcttt
ggctattacttcttcaattccatgatgggagttctacagctgctgcatatcttctgggcc
tacctcattttgcgcatggcccacaagttcataactggaaagctggtagaagatgaacgc
agtgaccgggaagaaacagagagctcagagggggaggaggctgcagctgggggaggagca
aagagccggcccctagccaatggccaccccatcctcaataacaaccatcgtaagaatgac
tga

KEGG   Homo sapiens (human): 79603Help
Entry
79603             CDS       T01001                                 

Gene name
CERS4, LASS4, Trh1
Definition
(RefSeq) ceramide synthase 4
  KO
K04710  ceramide synthetase [EC:2.3.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    79603 (CERS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    79603 (CERS4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     79603 (CERS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Motif
Other DBs
NCBI-GeneID: 79603
NCBI-ProteinID: NP_078828
OMIM: 615334
HGNC: 23747
Ensembl: ENSG00000090661
Vega: OTTHUMG00000172570
Pharos: Q9HA82(Tbio)
UniProt: Q9HA82 Q53HF9
LinkDB All DBs
Position
19p13.2
AA seq 394 aa AA seqDB search
MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFI
GLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRR
RRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLY
WWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHD
SSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFF
GYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPL
QLKNGAAGGPRPAPTDGPRSRVAGRLTNRHTTAT
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccagtttcaacgagtggttttggcaggacaggttctggttaccacccaatgtc
acgtggacagagctagaagaccgggatggccgtgtctacccccacccccaggacttgttg
gcagccctgcccctggcgctggtcctcctggccatgcgccttgcctttgagagattcatt
ggcctgcccctgagccggtggctgggtgtgagggatcagaccaggaggcaagtgaagccc
aacgccacgctggagaaacacttcctcacggaagggcacaggcccaaggagccccagctg
tctctcctggccgcccagtgtggcctcacgctgcagcagacccagcgatggttccggaga
cgccggaaccaggatcgaccccagctgaccaagaagttctgtgaggccagctggaggttt
ctcttctacctgtcctccttcgtgggcggcctctcggtcctgtaccacgagtcatggctg
tgggcaccagtaatgtgctgggacaggtacccaaaccagactctgaagccatccctgtac
tggtggtacctcttggagctgggtttctacctctcactgctaatcaggctgccctttgat
gtcaagcgcaaggatttcaaggagcaggtgatacaccacttcgtggcggtcatcctgatg
accttctcctacagtgccaacctgctgcgcattggctctctggtgctgctgttacacgat
tcctctgactacctgctggaggcctgtaagatggtcaactacatgcagtatcagcaagtg
tgcgacgctctcttcctcatcttctcctttgtcttcttctacacccgactggtcctcttt
cccacccagatcctctacaccacatactacgagtccatcagcaacaggggccccttcttc
ggctactacttcttcaacgggcttctgatgttgctgcagctgctgcacgtgttctggtct
tgcctcattctgcgcatgctctatagcttcatgaagaagggccagatggagaaggacatt
cgtagtgatgtagaagaatcagactccagtgaggaggcggcggcggcccaggaacctctg
cagctaaagaacggggcagctggagggcccaggccagcccccactgatggccctcggagc
cgggtggccgggcgtctgaccaacaggcacacaacagccacatag

KEGG   Homo sapiens (human): 91012Help
Entry
91012             CDS       T01001                                 

Gene name
CERS5, LASS5, Trh4
Definition
(RefSeq) ceramide synthase 5
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    91012 (CERS5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    91012 (CERS5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     91012 (CERS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Motif
Other DBs
NCBI-GeneID: 91012
NCBI-ProteinID: NP_671723
OMIM: 615335
HGNC: 23749
Ensembl: ENSG00000139624
Vega: OTTHUMG00000169819
Pharos: Q8N5B7(Tbio)
UniProt: Q8N5B7
LinkDB All DBs
Position
12q13.12
AA seq 392 aa AA seqDB search
MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFV
RLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR
KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPF
QPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVG
TLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFES
WEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEED
VTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagcagcgcagggacccctaagcttgctgtggggctggctgtggagcgagcgc
ttctggctacccgagaacgtgagctgggctgatctggaggggccggccgacggctacggt
tacccccgcggccggcacatcctctcggtgttcccgctggcggcgggcatcttcttcgtg
aggctgctcttcgagcgatttattgccaaaccctgtgcactctgtattggcatcgaggac
agtggtccttatcaggcccaacccaatgccatccttgaaaaggtgttcatatctattacc
aagtatcctgataagaaaaggctggagggcctgtcaaagcagctggattggaatgtccga
aaaatccaatgctggtttcgccatcggaggaatcaggacaagcccccaacgcttactaaa
ttctgtgaaagcatgtggagattcacattttatttatgtatattctgctatggaattaga
tttctctggtcgtcaccttggttctgggacatccgacagtgctggcataactatccattt
cagcctctttcaagtgggctttatcactattatatcatggaattggccttctattggtcc
cttatgttttctcagtttacagacattaaaagaaaggacttcctgatcatgtttgtgcat
cacttggtcaccattgggcttatctccttctcctacatcaacaatatggttcgagtggga
actctgatcatgtgtctacatgatgtctcagacttcttgctggaggcagccaaactggcc
aattatgccaagtatcagcggctctgtgacaccctttttgtgatcttcagtgctgttttt
atggttacacgactaggaatctatccattctggattctgaacacgaccctctttgagagt
tgggagataatcgggccttatgcttcatggtggctcctcaatggcctgctgctgacccta
cagcttctgcatgtcatctggtcctacctaattgcacggattgctttgaaagccttgatc
aggggaaaggtatcgaaggatgatcgcagtgatgtggagagcagctcagaggaagaagat
gtgaccacctgcacaaaaagtccctgtgacagtagctccagcaatggtgccaatcgggtg
aatggtcacatgggaggcagctactgggctgaagagtaa

DBGET integrated database retrieval system