KEGG   Homo sapiens (human): 10720
Entry
10720             CDS       T01001                                 

Gene name
UGT2B11
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B11
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04976  Bile secretion
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    10720 (UGT2B11)
   00053 Ascorbate and aldarate metabolism
    10720 (UGT2B11)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    10720 (UGT2B11)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    10720 (UGT2B11)
   00860 Porphyrin and chlorophyll metabolism
    10720 (UGT2B11)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    10720 (UGT2B11)
   00982 Drug metabolism - cytochrome P450
    10720 (UGT2B11)
   00983 Drug metabolism - other enzymes
    10720 (UGT2B11)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    10720 (UGT2B11)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    10720 (UGT2B11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    10720 (UGT2B11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     10720 (UGT2B11)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   10720 (UGT2B11)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 10720
NCBI-ProteinID: NP_001064
OMIM: 603064
HGNC: 12545
Ensembl: ENSG00000213759
Vega: OTTHUMG00000129395
Pharos: O75310(Tbio)
UniProt: O75310
LinkDB
Position
4q13.2
AA seq 529 aa
MTLKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKDSFWLYFSQEQEILWELY
DIFRNFCKDVVSNKKVMKKLQESRFDIVFADAVFPCGELLAALLNIRFVYSLRFTPGYTI
ERHSGGLIFPPSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMSDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNVDFVGGFHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRLDFNTM
SSTDLLNALKTVINDPLYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMPHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKFCLFCFWKFARKGKKGKRD
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgactctgaaatggacttcagttcttctgctgatacatctcagttgttactttagctct
gggagttgtggaaaagtgctggtgtgggccgcagaatacagccattggatgaatatgaag
acaatcctgaaagagcttgttcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaatgatgcatccactcttaaatttgaagtttatcctacatct
ttaactaaaactgaatttgagaatatcatcatgcaacaggttaagagatggtcagacatt
cgaaaagatagcttttggttatatttttcacaagaacaagaaatcctgtgggaattatat
gacatatttagaaacttctgtaaagatgtagtttcaaataagaaagttatgaaaaaacta
caagagtcaagatttgacatcgtttttgcagatgctgtttttccctgtggtgagctgctg
gctgcgctacttaacatacggtttgtgtacagtctccgctttactcctggctacacaatt
gaaaggcacagtggaggactgattttccctccttcctacatacctattgttatgtcaaaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttggttccaaatgtctgatatgaagaagtgggatcagttttacagtgaagtttta
ggaagacccactaccttatttgagacaatgggaaaagctgacatatggcttatgcgaaac
tcctggagttttcaatttcctcatccattcttaccaaacgttgattttgttggaggattc
cactgcaaacctgccaaacccctacctaaggaaatggaggagtttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcagtgataagtaacatgacagcagaaagg
gccaatgtaattgcaacagcccttgccaagatcccacaaaaggttctgtggagatttgac
gggaataaaccagatgccttaggtctcaatactcggctgtacaagtggataccccagaat
gaccttctaggtcatccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcaatctaccatgggatccctatggtgggcattccattgttttttgatcaacct
gataacattgctcacatgaaggccaagggagcagctgttagattggacttcaacacaatg
tcgagtacagacctgctgaatgcactgaagacagtaattaatgatcctttatataaagag
aatattatgaaattatcaagaattcaacatgatcaaccagtaaagcccctggatcgagca
gtcttctggattgaatttgtcatgccccacaaaggagccaaacaccttcgagttgcagcc
catgacctcacctggttccagtaccactctttggatgtgattgggtttctgctggcctgt
gtggcaactgtgatatttatcatcacaaagttttgtctgttttgtttctggaagtttgct
agaaaagggaagaagggaaaaagagattag

DBGET integrated database retrieval system