KEGG   Homo sapiens (human): 10733Help
Entry
10733             CDS       T01001                                 

Gene name
PLK4, MCCRP2, SAK, STK18
Definition
(RefSeq) polo like kinase 4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
Disease
H01880  Autosomal recessive microcephaly and chorioretinopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    10733 (PLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10733 (PLK4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10733 (PLK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     10733 (PLK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   10733 (PLK4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    10733 (PLK4)
   Centrosome duplication proteins
    Regulators of centriole replication
     10733 (PLK4)
  Sister chromatid separation proteins
   Polo kinases
    10733 (PLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 POLO_box Pkinase_fungal Haspin_kinase Kinase-like DUF4520
Motif
Other DBs
NCBI-GeneID: 10733
NCBI-ProteinID: NP_055079
OMIM: 605031
HGNC: 11397
Ensembl: ENSG00000142731
Vega: OTTHUMG00000133301
Pharos: O00444(Tchem)
UniProt: O00444
LinkDB All DBs
Structure
PDB: 

Position
4q28.1
AA seq 970 aa AA seqDB search
MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE
VKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQI
ITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISP
EIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKD
LIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSGHATISTAITASSST
SISGSLFDKRRLLIGQPLPNKMTVFPKNKSSTDFSSSGDGNSFYTQWGNQETSNSGRGRV
IQDAEERPHSRYLRRAYSSDRSGTSNSQSQAKTYTMERCHSAEMLSVSKRSGGGENEERY
SPTDNNANIFNFFKEKTSSSSGSFERPDNNQALSNHLCPGKTPFPFADPTPQTETVQQWF
GNLQINAHLRKTTEYDSISPNRDFQGHPDLQKDTSKNAWTDTKVKKNSDASDNAHSVKQQ
NTMKYMTALHSKPEIIQQECVFGSDPLSEQSKTRGMEPPWGYQNRTLRSITSPLVAHRLK
PIRQKTKKAVVSILDSEEVCVELVKEYASQEYVKEVLQISSDGNTITIYYPNGGRGFPLA
DRPPSPTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPG
ADFEVWFYDGVKIHKTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL
ALESIISEEERKTRSAPFFPIIIGRKPGSTSSPKALSPPPSVDSNYPTRERASFNRMVMH
SAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWAT
QLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILL
MFSNPTPNFH
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgcatcggggagaagatcgaggattttaaagttggaaatctgcttggtaaa
ggatcatttgctggtgtctacagagctgagtccattcacactggtttggaagttgcaatc
aaaatgatagataagaaagccatgtacaaagcaggaatggtacagagagtccaaaatgag
gtgaaaatacattgccaattgaaacatccttctatcttggagctttataactattttgaa
gatagcaattatgtgtatctggtattagaaatgtgccataatggagaaatgaacaggtat
ctaaagaatagagtgaaacccttctcagaaaatgaagctcgacacttcatgcaccagatc
atcacagggatgttgtatcttcattctcatggtatactacaccgggacctcacactttct
aacctcctactgactcgtaatatgaacatcaagattgctgattttgggctggcaactcaa
ctgaaaatgccacatgaaaagcactatacattatgtggaactcctaactacatttcacca
gaaattgccactcgaagtgcacatggccttgaatctgatgtttggtccctgggctgtatg
ttttatacattacttatcgggagaccacccttcgacactgacacagtcaagaacacatta
aataaagtagtattggcagattatgaaatgccatcttttttgtcaatagaggccaaggac
cttattcaccagttacttcgtagaaatccagcagatcgtttaagtctgtcttcagtattg
gaccatccttttatgtcccgaaattcttcaacaaaaagtaaagatttaggaactgtggaa
gactcaattgatagtgggcatgccacaatttctactgcaattacagcttcttccagtacc
agtataagtggtagtttatttgacaaaagaagacttttgattggtcagccactcccaaat
aaaatgactgtatttccaaagaataaaagttcaactgatttttcttcttcaggagatgga
aacagtttttatactcagtggggaaatcaagaaaccagtaatagtggaaggggaagagta
attcaagatgcagaagaaaggccacattctcgataccttcgtagagcttattcctctgat
agatctggcacttctaatagtcagtctcaagcaaaaacatatacaatggaacgatgtcac
tcagcagaaatgctttcagtgtccaaaagatcaggaggaggtgaaaatgaagagaggtac
tcacccacagacaacaatgccaacatttttaacttctttaaagaaaagacatccagtagt
tctggatcttttgaaagacctgataacaatcaagcactctccaatcatctttgtccagga
aaaactccttttccatttgcagacccgacacctcagactgaaaccgtacaacagtggttt
gggaatctgcaaataaatgctcatttaagaaaaactactgaatatgacagcatcagccca
aaccgggacttccagggccatccagatttgcagaaggacacatcaaaaaatgcctggact
gatacaaaagtcaaaaagaactctgatgcttctgataatgcacattctgtaaaacagcaa
aataccatgaaatatatgactgcacttcacagtaaacctgagataatccaacaagaatgt
gtttttggctcagatcctctttctgaacagagcaagactaggggtatggagccaccatgg
ggttatcagaatcgtacattaagaagcattacatctccgttggttgctcacaggttaaaa
ccaatcagacagaaaaccaaaaaggctgtggtgagcatacttgattcagaggaggtgtgt
gtggagcttgtaaaggagtatgcatctcaagaatatgtgaaagaagttcttcagatatct
agtgatggaaatacgatcactatttattatccaaatggtggtagaggttttcctcttgct
gatagaccaccctcacctactgacaacatcagtaggtacagctttgacaatttaccagaa
aaatactggcgaaaatatcaatatgcttccaggtttgtacagcttgtaagatctaaatct
cccaaaatcacttattttacaagatatgctaaatgcattttgatggagaattctcctggt
gctgattttgaggtttggttttatgatggggtaaaaatacacaaaacagaagatttcatt
caggtgattgaaaagacagggaagtcttacactttaaaaagtgaaagtgaagttaatagc
ttgaaagaggagataaaaatgtatatggaccatgctaatgagggtcatcgtatttgttta
gcactggaatccataatttcagaagaggaaaggaaaactaggagtgctccctttttccca
ataatcataggaagaaaacctggtagtactagttcacctaaggccttatcacctcctcct
tctgtggattcaaattacccaacgagagagagagcatctttcaacagaatggtcatgcat
agtgctgcttctccaacacaggcaccaatccttaatccctctatggttacaaatgaagga
cttggtcttacaactacagcttctggaacagacatctcttctaatagtctaaaagattgt
cttcctaaatcagcacaacttttgaaatctgtttttgtgaaaaatgttggttgggctaca
cagttaactagtggagctgtgtgggttcagtttaatgatgggtcccagttggttgtgcag
gcaggagtgtcttctatcagttatacctcaccaaatggtcaaacaactaggtatggagaa
aatgaaaaattaccagactacatcaaacagaaattacagtgtctgtcttccatccttttg
atgttttctaatccgactcctaattttcattga

KEGG   Homo sapiens (human): 10769Help
Entry
10769             CDS       T01001                                 

Gene name
PLK2, SNK, hPlk2, hSNK
Definition
(RefSeq) polo like kinase 2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    10769 (PLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10769 (PLK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10769 (PLK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     10769 (PLK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   10769 (PLK2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    10769 (PLK2)
   Centrosome duplication proteins
    Regulators of centriole replication
     10769 (PLK2)
  Sister chromatid separation proteins
   Polo kinases
    10769 (PLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like G_path_suppress
Motif
Other DBs
NCBI-GeneID: 10769
NCBI-ProteinID: NP_006613
OMIM: 607023
HGNC: 19699
Ensembl: ENSG00000145632
Vega: OTTHUMG00000097047
Pharos: Q9NYY3(Tchem)
UniProt: Q9NYY3 A0A024QZV1
LinkDB All DBs
Structure
PDB: 

Position
5q11.2
AA seq 685 aa AA seqDB search
MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHH
HHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK
PHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEP
EVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTI
CGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPA
KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLR
GCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPD
KKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL
YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTL
LMSGCSSELKNRMEYALNMLLQRCN
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggagcttttgcggactatcacctaccagccagccgccagcaccaaaatgtgcgagcag
gcgctgggcaagggttgcggagcggactcgaagaagaagcggccgccgcagccccccgag
gaatcgcagccacctcagtcccaggcgcaagtgcccccggcggcccctcaccaccatcac
caccattcgcactcggggccggagatctcgcggattatcgtcgaccccacgactgggaag
cgctactgccggggcaaagtgctgggaaagggtggctttgcaaaatgttacgagatgaca
gatttgacaaataacaaagtctacgccgcaaaaattattcctcacagcagagtagctaaa
cctcatcaaagggaaaagattgacaaagaaatagagcttcacagaattcttcatcataag
catgtagtgcagttttaccactacttcgaggacaaagaaaacatttacattctcttggaa
tactgcagtagaaggtcaatggctcatattttgaaagcaagaaaggtgttgacagagcca
gaagttcgatactacctcaggcagattgtgtctggactgaaataccttcatgaacaagaa
atcttgcacagagatctcaaactagggaacttttttattaatgaagccatggaactaaaa
gttggggacttcggtctggcagccaggctagaacccttggaacacagaaggagaacgata
tgtggtaccccaaattatctctctcctgaagtcctcaacaaacaaggacatggctgtgaa
tcagacatttgggccctgggctgtgtaatgtatacaatgttactagggaggcccccattt
gaaactacaaatctcaaagaaacttataggtgcataagggaagcaaggtatacaatgccg
tcctcattgctggctcctgccaagcacttaattgctagtatgttgtccaaaaacccagag
gatcgtcccagtttggatgacatcattcgacatgacttttttttgcagggcttcactccg
gacagactgtcttctagctgttgtcatacagttccagatttccacttatcaagcccagct
aagaatttctttaagaaagcagctgctgctctttttggtggcaaaaaagacaaagcaaga
tatattgacacacataatagagtgtctaaagaagatgaagacatctacaagcttaggcat
gatttgaaaaagacttcaataactcagcaacccagcaaacacaggacagatgaggagctc
cagccacctaccaccacagttgccaggtctggaacacccgcagtagaaaacaagcagcag
attggggatgctattcggatgatagtcagagggactcttggcagctgtagcagcagcagt
gaatgccttgaagacagtaccatgggaagtgttgcagacacagtggcaagggttcttcgg
ggatgtctggaaaacatgccggaagctgattgcattcccaaagagcagctgagcacatca
tttcagtgggtcaccaaatgggttgattactctaacaaatatggctttgggtaccagctc
tcagaccacaccgtcggtgtccttttcaacaatggtgctcacatgagcctccttccagac
aaaaaaacagttcactattacgcagagcttggccaatgctcagttttcccagcaacagat
gctcctgagcaatttattagtcaagtgacggtgctgaaatacttttctcattacatggag
gagaacctcatggatggtggagatctgcctagtgttactgatattcgaagacctcggctc
tacctccttcagtggctaaaatctgataaggccctaatgatgctctttaatgatggcacc
tttcaggtgaatttctaccatgatcatacaaaaatcatcatctgtagccaaaatgaagaa
taccttctcacctacatcaatgaggataggatatctacaactttcaggctgacaactctg
ctgatgtctggctgttcatcagaattaaaaaatcgaatggaatatgccctgaacatgctc
ttacaaagatgtaactga

KEGG   Homo sapiens (human): 1263Help
Entry
1263              CDS       T01001                                 

Gene name
PLK3, CNK, FNK, PLK-3, PRK
Definition
(RefSeq) polo like kinase 3
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    1263 (PLK3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    1263 (PLK3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    1263 (PLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1263 (PLK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1263 (PLK3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1263 (PLK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     1263 (PLK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   1263 (PLK3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Polo kinases
    1263 (PLK3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    1263 (PLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 1263
NCBI-ProteinID: NP_004064
OMIM: 602913
HGNC: 2154
Ensembl: ENSG00000173846
Vega: OTTHUMG00000008491
Pharos: Q9H4B4(Tchem)
UniProt: Q9H4B4
LinkDB All DBs
Structure
PDB: 

Position
1p34.1
AA seq 646 aa AA seqDB search
MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGR
TYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHR
HIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRG
ILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE
ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR
DRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKN
HAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDG
FEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQL
SSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYME
QHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP
LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgccgccggtttcctgtctccgcgccccttccagcgtgcggccgccgcgccc
gctcccccggccgggcccgggccgcctccgagtgccttgcgcggacctgagctggagatg
ctggccgggctaccgacgtcagaccccgggcgcctcatcacggacccgcgcagcggccgc
acctacctcaaaggccgcttgttgggcaaggggggcttcgcccgctgctacgaggccact
gacacagagactggcagcgcctacgctgtcaaagtcatcccgcagagccgcgtcgccaag
ccgcatcagcgcgagaagatcctaaatgagattgagctgcaccgagacctgcagcaccgc
cacatcgtgcgtttttcgcaccactttgaggacgctgacaacatctacattttcttggag
ctctgcagccgaaagtccctggcccacatctggaaggcccggcacaccctgttggagcca
gaagtgcgctactacctgcggcagatcctttctggcctcaagtacttgcaccagcgcggc
atcttgcaccgggacctcaagttgggaaattttttcatcactgagaacatggaactgaag
gtgggggattttgggctggcagcccggttggagcctccggagcagaggaagaagaccatc
tgtggcacccccaactatgtggctccagaagtgctgctgagacagggccacggccctgag
gcggatgtatggtcactgggctgtgtcatgtacacgctgctctgcgggagccctcccttt
gagacggctgacctgaaggagacgtaccgctgcatcaagcaggttcactacacgctgcct
gccagcctctcactgcctgcccggcagctcctggccgccatccttcgggcctcaccccga
gaccgcccctctattgaccagatcctgcgccatgacttctttaccaagggctacaccccc
gatcgactccctatcagcagctgcgtgacagtcccagacctgacaccccccaacccagct
aggagtctgtttgccaaagttaccaagagcctctttggcagaaagaagaagagtaagaat
catgcccaggagagggatgaggtctccggtttggtgagcggcctcatgcgcacatccgtt
ggccatcaggatgccaggccagaggctccagcagcttctggcccagcccctgtcagcctg
gtagagacagcacctgaagacagctcaccccgtgggacactggcaagcagtggagatgga
tttgaagaaggtctgactgtggccacagtagtggagtcagccctttgtgctctgagaaat
tgtatagccttcatgcccccagcggaacagaacccggcccccctggcccagccagagcct
ctggtgtgggtcagcaagtgggttgactactccaataagttcggctttgggtatcaactg
tccagccgccgtgtggctgtgctcttcaacgatggcacacatatggccctgtcggccaac
agaaagactgtgcactacaatcccaccagcacaaagcacttctccttctccgtgggtgct
gtgccccgggccctgcagcctcagctgggtatcctgcggtacttcgcctcctacatggag
cagcacctcatgaagggtggagatctgcccagtgtggaagaggtagaggtacctgctccg
cccttgctgctgcagtgggtcaagacggatcaggctctcctcatgctgtttagtgatggc
actgtccaggtgaacttctacggggaccacaccaagctgattctcagtggctgggagccc
ctccttgtgacttttgtggcccgaaatcgtagtgcttgtacttacctcgcttcccacctt
cggcagctgggctgctctccagacctgcggcagcgactccgctatgctctgcgcctgctc
cgggaccgcagcccagcctag

KEGG   Homo sapiens (human): 5347Help
Entry
5347              CDS       T01001                                 

Gene name
PLK1, PLK, STPK13
Definition
(RefSeq) polo like kinase 1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Drug target
Onvansertib (DG03017): D11458 D11459
Rigosertib (DG01416): D10154 D10155
Volasertib (DG01417): D10182 D10183
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    5347 (PLK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5347 (PLK1)
   04114 Oocyte meiosis
    5347 (PLK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    5347 (PLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5347 (PLK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5347 (PLK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     5347 (PLK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   5347 (PLK1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     5347 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5347 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    5347 (PLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 5347
NCBI-ProteinID: NP_005021
OMIM: 602098
HGNC: 9077
Ensembl: ENSG00000166851
Vega: OTTHUMG00000096984
Pharos: P53350(Tchem)
UniProt: P53350
LinkDB All DBs
Structure
PDB: 

Position
16p12.2
AA seq 603 aa AA seqDB search
MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFF
EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEE
PVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTK
LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
KAS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgcagtgactgcagggaagctggcacgggcaccggccgaccctgggaaagcc
ggggtccccggagttgcagctcccggagctccggcggcggctccaccggcgaaagagatc
ccggaggtcctagtggacccacgcagccggcggcgctatgtgcggggccgctttttgggc
aagggcggctttgccaagtgcttcgagatctcggacgcggacaccaaggaggtgttcgcg
ggcaagattgtgcctaagtctctgctgctcaagccgcaccagagggagaagatgtccatg
gaaatatccattcaccgcagcctcgcccaccagcacgtcgtaggattccacggctttttc
gaggacaacgacttcgtgttcgtggtgttggagctctgccgccggaggtctctcctggag
ctgcacaagaggaggaaagccctgactgagcctgaggcccgatactacctacggcaaatt
gtgcttggctgccagtacctgcaccgaaaccgagttattcatcgagacctcaagctgggc
aaccttttcctgaatgaagatctggaggtgaaaataggggattttggactggcaaccaaa
gtcgaatatgacggggagaggaagaagaccctgtgtgggactcctaattacatagctccc
gaggtgctgagcaagaaagggcacagtttcgaggtggatgtgtggtccattgggtgtatc
atgtataccttgttagtgggcaaaccaccttttgagacttcttgcctaaaagagacctac
ctccggatcaagaagaatgaatacagtattcccaagcacatcaaccccgtggccgcctcc
ctcatccagaagatgcttcagacagatcccactgcccgcccaaccattaacgagctgctt
aatgacgagttctttacttctggctatatccctgcccgtctccccatcacctgcctgacc
attccaccaaggttttcgattgctcccagcagcctggaccccagcaaccggaagcccctc
acagtcctcaataaaggcttggagaaccccctgcctgagcgtccccgggaaaaagaagaa
ccagtggttcgagagacaggtgaggtggtcgactgccacctcagtgacatgctgcagcag
ctgcacagtgtcaatgcctccaagccctcggagcgtgggctggtcaggcaagaggaggct
gaggatcctgcctgcatccccatcttctgggtcagcaagtgggtggactattcggacaag
tacggccttgggtatcagctctgtgataacagcgtgggggtgctcttcaatgactcaaca
cgcctcatcctctacaatgatggtgacagcctgcagtacatagagcgtgacggcactgag
tcctacctcaccgtgagttcccatcccaactccttgatgaagaagatcaccctccttaaa
tatttccgcaattacatgagcgagcacttgctgaaggcaggtgccaacatcacgccgcgc
gaaggtgatgagctcgcccggctgccctacctacggacctggttccgcacccgcagcgcc
atcatcctgcacctcagcaacggcagcgtgcagatcaacttcttccaggatcacaccaag
ctcatcttgtgcccactgatggcagccgtgacctacatcgacgagaagcgggacttccgc
acataccgcctgagtctcctggaggagtacggctgctgcaaggagctggccagccggctc
cgctacgcccgcactatggtggacaagctgctgagctcacgctcggccagcaaccgtctc
aaggcctcctaa

DBGET integrated database retrieval system