KEGG   Homo sapiens (human): 10746Help
Entry
10746             CDS       T01001                                 

Gene name
MAP3K2, MEKK2, MEKK2B
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 2
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04540  Gap junction
hsa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    10746 (MAP3K2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    10746 (MAP3K2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    10746 (MAP3K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10746 (MAP3K2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     10746 (MAP3K2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   10746 (MAP3K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like FTA2 Kdo
Motif
Other DBs
NCBI-GeneID: 10746
NCBI-ProteinID: NP_006600
OMIM: 609487
HGNC: 6854
Ensembl: ENSG00000169967
Vega: OTTHUMG00000153397
Pharos: Q9Y2U5(Tchem)
UniProt: Q9Y2U5 A0A024RAH0
LinkDB All DBs
Structure
PDB: 

Position
2q14.3
AA seq 619 aa AA seqDB search
MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFP
RPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLV
INGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARN
GSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSY
PDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSLRSPVS
FSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGK
LLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIV
HRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR
KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVE
AKLRPSADELLRHMFVHYH
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcagcaagctttgaactcaatcatgcaagatttggctgtccttcataaggcc
agtcgaccagcattatccttgcaggaaaccagaaaagcaaaatcttcatcaccaaaaaaa
cagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatccttcagttcccc
agaccagttaaactggaagatctgagatctaaagctaaaattgcctttggacagtctatg
gatctacattataccaataacgagttggtaattccattaactactcaagatgacttggac
aaagctgtggaactgctggatcgtagtattcatatgaagagcctcaagatattacttgta
ataaatggaagtacacaggctactaatttagaaccattgccatcactagaagatttggat
aatacagtatttggagcagagaggaaaaaacggctatctataataggtcctactagtaga
gatagaagttctcctcccccaggttacattccagatgaattacaccaggttgcccggaat
gggtcattcactagtatcaacagtgaaggagagttcattccagagagcatggaccaaatg
ctggatccattatctttaagcagccctgaaaattctggctcaggaagttgtccatcactt
gatagtcctttggatggagagagctatccaaaatcacgaatgcctagggctcagagctac
ccagataatcatcaggaattttcagactatgataaccctatctttgagaaatttggaaaa
ggaggaacatatccaagaaggtatcatgtttcatatcatcatcaagagtataatgatggt
cgtaaaacttttccaagagctagaaggacccaggggaccagcttacggtctcctgtgagt
ttcagtcctactgatcattccttaagcactagtagtggaagcagtatctttaccccagag
tatgatgatagtcgaataagaagaaggggaagtgacatagacaatcctactttgaccgta
atggacatcagcccacccagccgttcacctcgagctccgaccaactggagattgggcaaa
ctgcttggccaaggagcctttggaagggtctacctctgttatgatgttgatacaggaaga
gaattggctgttaagcaagttcaatttgaccccgatagtcctgagaccagcaaggaagta
aatgcacttgagtgtgaaattcagttgctgaaaaacttgctacatgagcgaattgttcag
tattatggctgtttgagggatccccaggaaaaaacactttccatatttatggaatatatg
ccagggggttcaattaaggaccaattaaaagcatatggcgctcttactgagaatgtgact
aggaaatacacccgtcagattctggagggtgtccattatttgcacagtaatatgattgtc
catagagatatcaaaggcgcaaatatcctgcgagattcaacaggcaacgtcaaactagga
gattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaagtct
gtcacgggcacaccatactggatgagccctgaagtcatcagtggagaaggctatggaaga
aaagcagacatctggagtgttgcatgtactgtggtagaaatgctaactgaaaagccgcct
tgggctgaatttgaagcaatggctgccatctttaaaatcgccactcagccaacaaaccca
aagctgccacctcatgtctcagactatactcgagatttcctcaaacggatttttgtagag
gccaaactgagaccttcagctgatgaactcttaaggcacatgtttgtgcattatcactag

KEGG   Homo sapiens (human): 4214Help
Entry
4214              CDS       T01001                                 

Gene name
MAP3K1, MAPKKK1, MEKK, MEKK_1, MEKK1, SRXY6
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04530  Tight junction
hsa04622  RIG-I-like receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04912  GnRH signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06110  MAPK signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06263  Hepatocellular carcinoma
  Element
N00542  EGF-EGFR-RAS-JNK signaling pathway
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4214 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4214 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4214 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    4214 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    4214 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    4214 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4214 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4214 (MAP3K1)
   05161 Hepatitis B
    4214 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4214 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    4214 (MAP3K1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4214 (MAP3K1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4214 (MAP3K1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4214 (MAP3K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal zf-RING_2 PHD APH Phostensin_N FANCL_C zf-ANAPC11
Motif
Other DBs
NCBI-GeneID: 4214
NCBI-ProteinID: NP_005912
OMIM: 600982
HGNC: 6848
Ensembl: ENSG00000095015
Vega: OTTHUMG00000059486
Pharos: Q13233(Tbio)
UniProt: Q13233
LinkDB All DBs
Position
5q11.2
AA seq 1512 aa AA seqDB search
MAAAAGNRASSSGFPGARATSPEAGGGGGALKASSAPAAAAGLLREAGSGGRERADWRRR
QLRKVRSVELDQLPEQPLFLAASPPASSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRG
GAHLTESVAAPDSGASSPAAAEPGEKRAPAAEPSPAAAPAGREMENKETLKGLHKMDDRP
EERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHLAAESPGEVQASA
ASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYS
PEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCARGTFCIHLLF
VMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECR
RNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTVQQQPLAGSRRNQESNFN
LTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANG
ESTGNSGGSSGSSPSGGATSGSSQTSISGDVVEACCSVLSMVCADPVYKVYVAALKTLRA
MLVYTPCHSLAERIKLQRLLQPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAVG
REILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTD
VSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLEM
LSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASVPNNYLETTENS
SPECTVHLEKTGKGLCATKLSASSEDISERLASISVGPSSSTTTTTTTTEQPKPMVQTKG
RPHSQCLNSSPLSHHSQLMFPALSTPSSSTPSVPAGTATDVSKHRLQGFIPCRIPSASPQ
TQRKFSLQFHRNCPENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSKQGDPSKNS
MTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASM
PSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQD
ALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQA
QDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYN
LFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDST
GQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAII
EMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSR
ELLKHPVFRTTW
NT seq 4539 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccagggctacg
agccctgaggcaggcggcggcggaggagccctcaaggcgagcagcgcgcccgcggctgcc
gcgggactgctgcgggaggcgggcagcgggggccgcgagcgggcggactggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccagctgcctgagcagccgctcttcctt
gccgcctcaccgccggcctcctcgacttccccgtcgccggagcccgcggacgcagcgggg
agtgggaccggcttccagcctgtggcggtgccgccgccccacggagccgcgagccgcggc
ggcgcccaccttaccgagtcggtggcggcgccggacagcggcgcctcgagtcccgcagcg
gccgagcccggggagaagcgggcgcccgccgccgagccgtctcctgcagcggcccccgcc
ggtcgtgagatggagaataaagaaactctcaaagggttgcacaagatggatgatcgtcca
gaggaacgaatgatcagggagaaactgaaggcaacctgtatgccagcctggaagcacgaa
tggttggaaaggagaaataggcgagggcctgtggtggtaaaaccaatcccagttaaagga
gatggatctgaaatgaatcacttagcagctgagtctccaggagaggtccaggcaagtgcg
gcttcaccagcttccaaaggccgacgcagtccttctcctggcaactccccatcaggtcgc
acagtgaaatcagaatctccaggagtaaggagaaaaagagtttccccagtgccttttcag
agtggcagaatcacaccaccccgaagagccccttcaccagatggcttctcaccatatagc
cctgaggaaacaaaccgccgtgttaacaaagtgatgcgggccagactgtacttactgcag
cagatagggcctaactctttcctgattggaggagacagcccagacaataaataccgggtg
tttattgggcctcagaactgcagctgtgcacgtggaacattctgtattcatctgctattt
gtgatgctccgggtgtttcaactagaaccttcagacccaatgttatggagaaaaacttta
aagaattttgaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatc
aaagctccatctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcataca
ttgtcatcatctagtacttctacgtctagttcagaaaacagcataaaggatgaagaggaa
cagatgtgtcctatttgcttgttgggcatgcttgatgaagaaagtcttacagtgtgtgaa
gacggctgcaggaacaagctgcaccaccactgcatgtcaatttgggcagaagagtgtaga
agaaatagagaacctttaatatgtcccctttgtagatctaagtggagatctcatgatttc
tacagccacgagttgtcaagtcctgtggattccccttcttccctcagagctgcacagcag
caaaccgtacagcagcagcctttggctggatcacgaaggaatcaagagagcaattttaac
cttactcattatggaactcagcaaatccctcctgcttacaaagatttagctgagccatgg
attcaggtgtttggaatggaactcgttggctgcttattttctagaaactggaatgtgaga
gagatggccctcaggcgtctttcccatgatgtcagtggggccctgctgttggcaaatggg
gagagcactggaaattctgggggcagcagtggaagcagcccgagtgggggagccaccagt
gggtcttcccagaccagtatctcaggagatgtggtggaggcatgctgcagcgttctgtca
atggtctgtgctgaccctgtctacaaagtgtacgttgctgctttaaaaacattgagagcc
atgctggtatatactccttgccacagtttagcggaaagaatcaaacttcagagacttctc
cagccagttgtagacaccatcctagtcaaatgtgcagatgccaatagccgcacaagtcag
ctgtccatatcaacactgttggaactgtgcaaaggccaagcaggagagttggcagttggc
agagaaatactaaaagctggatccattggtattggtggtgttgattatgtcttaaattgt
attcttggaaaccaaactgaatcaaacaattggcaagaacttcttggccgcctttgtctt
atagatagactgttgttggaatttcctgctgaattttatcctcatattgtcagtactgat
gtttcacaagctgagcctgttgaaatcaggtataagaagctgctgtccctcttaaccttt
gctttgcagtccattgataattcccactcaatggttggcaaactttccagaaggatctac
ttgagttctgcaagaatggttactacagtaccccatgtgttttcaaaactgttagaaatg
ctgagtgtttccagttccactcacttcaccaggatgcgtcgccgtttgatggctattgca
gatgaggtggaaattgccgaagccatccagttgggcgtagaagacactttggatggtcaa
caggacagcttcttgcaggcatctgttcccaacaactatctggaaaccacagagaacagt
tcccctgagtgcacagtccatttagagaaaactggaaaaggattatgtgctacaaaattg
agtgccagttcagaggacatttctgagagactggccagcatttcagtaggaccttctagt
tcaacaacaacaacaacaacaacaacagagcaaccaaagccaatggttcaaacaaaaggc
agaccccacagtcagtgtttgaactcctctcctttatctcatcattcccaattaatgttt
ccagccttgtcaaccccttcttcttctaccccatctgtaccagctggcactgcaacagat
gtctctaagcatagacttcagggattcattccctgcagaataccttctgcatctcctcaa
acacagcgcaagttttctctacaattccacagaaactgtcctgaaaacaaagactcagat
aaactttccccagtctttactcagtcaagacccttgccctccagtaacatacacaggcca
aagccatctagacctaccccaggtaatacaagtaaacagggagatccctcaaaaaatagc
atgacacttgatctgaacagtagttccaaatgtgatgacagctttggctgtagcagcaat
agtagtaatgctgttatacccagtgacgagacagtgttcaccccagtagaggagaaatgc
agattagatgtcaatacagagctcaactccagtattgaggaccttcttgaagcatctatg
ccttcaagtgatacaacagtaacttttaagtcagaagttgctgtcctgtctcctgaaaag
gctgaaaatgatgatacctacaaagatgatgtgaatcataatcaaaagtgcaaagagaag
atggaagctgaagaagaagaagctttagcaattgccatggcaatgtcagcgtctcaggat
gccctccccatagttcctcagctgcaggttgaaaatggagaagatatcatcattattcaa
caggatacaccagagactctaccaggacataccaaagcaaaacaaccgtatagagaagac
actgaatggctgaaaggtcaacagataggccttggagcattttcttcttgttatcaggct
caagatgtgggaactggaactttaatggctgttaaacaggtgacttatgtcagaaacaca
tcttctgagcaagaagaagtagtagaagcactaagagaagagataagaatgatgagccat
ctgaatcatccaaacatcattaggatgttgggagccacgtgtgagaagagcaattacaat
ctcttcattgaatggatggcagggggatcggtggctcatttgctgagtaaatatggagcc
ttcaaagaatcagtagttattaactacactgaacagttactccgtggcctttcgtatctc
catgaaaaccaaatcattcacagagatgtcaaaggtgccaatttgctaattgacagcact
ggtcagagactaagaattgcagattttggagctgcagccaggttggcatcaaaaggaact
ggtgcaggagagtttcagggacaattactggggacaattgcatttatggcacctgaggta
ctaagaggtcaacagtatggaaggagctgtgatgtatggagtgttggctgtgctattata
gaaatggcttgtgcaaaaccaccatggaatgcagaaaaacactccaatcatcttgctttg
atatttaagattgctagtgcaactactgctccatcgatcccttcacatttgtctcctggt
ttacgagatgtggctcttcgttgtttagaacttcaacctcaggacagacctccatcaaga
gagctactgaagcatccagtctttcgtactacatggtag

KEGG   Homo sapiens (human): 4215Help
Entry
4215              CDS       T01001                                 

Gene name
MAP3K3, MAPKKK3, MEKK3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04912  GnRH signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4215 (MAP3K3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    4215 (MAP3K3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4215 (MAP3K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4215 (MAP3K3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4215 (MAP3K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4215 (MAP3K3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4215 (MAP3K3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4215 (MAP3K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 4215
NCBI-ProteinID: NP_002392
OMIM: 602539
HGNC: 6855
Ensembl: ENSG00000198909
Vega: OTTHUMG00000178905
Pharos: Q99759(Tchem)
UniProt: Q99759
LinkDB All DBs
Structure
PDB: 

Position
17q23.3
AA seq 626 aa AA seqDB search
MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAF
SRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPG
YVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSF
RKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRR
HQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPI
NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ
HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYL
HSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVIS
GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
RRIFVEARQRPSAEELLTHHFAQLMY
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacaggaggcattgaactcaatcatgaacgatctggtggccctccagatgaac
cgacgtcaccggatgcctggatatgagaccatgaagaacaaagacacaggtcactcaaat
aggcagagtgacgtcagaatcaagttcgagcacaacggggagaggcgaattatagcgttc
agccggcctgtgaaatatgaagatgtggagcacaaggtgacaacagtatttggacaacct
cttgatctacattacatgaacaatgagctctccatcctgctgaaaaaccaagatgatctt
gataaagcaattgacattttagatagaagctcaagcatgaaaagccttaggatattgctg
ttgtcccaggacagaaaccataacagttcctctccccactctggggtgtccagacaggtg
cggatcaaggcttcccagtccgcaggggatataaatactatctaccagccccccgagccc
agaagcaggcacctctctgtcagctcccagaaccctggccgaagctcacctccccctggc
tatgttcctgagcggcagcagcacattgcccggcaggggtcctacaccagcatcaacagt
gagggggagttcatcccagagaccagcgagcagtgcatgctggatcccctgagcagtgca
gaaaattccttgtctggaagctgccaatccttggacaggtcagcagacagcccatccttc
cggaaatcacgaatgtcccgtgcccagagcttccctgacaacagacaggaatactcagat
cgggaaactcagctttatgacaaaggggtcaaaggtggaacctacccccggcgctaccac
gtgtctgtgcaccacaaggactacagtgatggcagaagaacatttccccgaatacggcgt
catcaaggcaacttgttcaccctggtgccctccagccgctccctgagcacaaatggcgag
aacatgggtctggctgtgcaatacctggacccccgtgggcgcctgcggagtgcggacagc
gagaatgccctctctgtgcaggagaggaatgtgccaaccaagtctcccagtgcccccatc
aactggcgccggggaaagctcctgggccagggtgccttcggcagggtctatttgtgctat
gacgtggacacgggacgtgaacttgcttccaagcaggtccaatttgatccagacagtcct
gagacaagcaaggaggtgagtgctctggagtgcgagatccagttgctaaagaacttgcag
catgagcgcatcgtgcagtactatggctgtctgcgggaccgcgctgagaagaccctgacc
atcttcatggagtacatgccagggggctcggtgaaagaccagttgaaggcttacggtgct
ctgacagagagcgtgacccgaaagtacacgcggcagatcctggagggcatgtcctacctg
cacagcaacatgattgttcaccgggacattaagggagccaacatcctccgagactctgct
gggaatgtaaagctgggggactttggggccagcaaacgcctgcagacgatctgtatgtcg
gggacgggcatgcgctccgtcactggcacaccctactggatgagccctgaggtgatcagc
ggcgagggctatggaaggaaagcagacgtgtggagcctgggctgcactgtggtggagatg
ctgacagagaaaccaccgtgggcagagtatgaagctatggccgccatcttcaagattgcc
acccagcccaccaatcctcagctgccctcccacatctctgaacatggccgggacttcctg
aggcgcatttttgtggaggctcgccagagaccttcagctgaggagctgctcacacaccac
tttgcacagctcatgtactga

KEGG   Homo sapiens (human): 4216Help
Entry
4216              CDS       T01001                                 

Gene name
MAP3K4, MAPKKK4, MEKK_4, MEKK4, MTK1, PRO0412
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 4
  KO
K04428  mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4216 (MAP3K4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    4216 (MAP3K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4216 (MAP3K4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4216 (MAP3K4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4216 (MAP3K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 4216
NCBI-ProteinID: NP_005913
OMIM: 602425
HGNC: 6856
Ensembl: ENSG00000085511
Vega: OTTHUMG00000015968
Pharos: Q9Y6R4(Tbio)
UniProt: Q9Y6R4 Q9P1M2
LinkDB All DBs
Position
6q26
AA seq 1608 aa AA seqDB search
MREAAAALVPPPAFAVTPAAAMEEPPPPPPPPPPPPEPETESEPECCLAARQEGTLGDSA
CKSPESDLEDFSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAP
NQPPHKDTGKTVENVEEYSYKQEKKIRAALRTTERDRKKNVQCSFMLDSVGGSLPKKSIP
DVDLNKPYLSLGCSNAKLPVSVPMPIARPARQTSRTDCPADRLKFFETLRLLLKLTSVSK
KKDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAIPDIINEILT
FKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVSFEQVKRIMEL
LEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLS
DIGWPVFEIPSPRPSKGNEPEYEGDDTEGELKELESSTDESEEEQISDPRVPEIRQPIDN
SFDIQSRDCISKKLERLESEDDSLGWGAPDWSTEAGFSRHCLTSIYRPFVDKALKQMGLR
KLILRLHKLMDGSLQRARIALVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVS
WEELKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLK
GGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMVYFDYMRSWIQMLQQLPQASH
SLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTS
ADDSSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRD
LLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAY
LLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRK
AFQQSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEV
DESESVTLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFARKWMNYVLTK
CESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGL
YLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAV
AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEP
AYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQ
VCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPND
HKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVI
RLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVN
STLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGM
GHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE
NT seq 4827 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagccgctgccgcgctggtccctcctcccgcctttgccgtcacgcctgccgcc
gccatggaggagccgccgccaccgccgccgccgccaccaccgccaccggaacccgagacc
gagtcagaacccgagtgctgcttggcggcgaggcaagagggcacattgggagattcagct
tgcaagagtcctgaatctgatctagaagacttctccgatgaaacaaatacagagaatctt
tatggtacctctccccccagcacacctcgacagatgaaacgcatgtcaaccaaacatcag
aggaataatgtggggaggccagccagtcggtctaatttgaaagaaaaaatgaatgcacca
aatcagcctccacataaagacactggaaaaacagtggagaatgtggaagaatacagctat
aagcaggagaaaaagatccgagcagctcttagaacaacagagcgtgatcgtaaaaaaaat
gtacagtgctcattcatgttagactcagtgggtggatctttgccaaaaaaatcaattcca
gatgtggatctcaataagccttacctcagccttggctgtagcaatgctaagcttccagta
tctgtgcccatgcctatagccagacctgcacgccagacttctaggactgactgtccagca
gatcgtttaaagttttttgaaactttacgacttttgctaaagcttacctcagtctcaaag
aaaaaagacagggagcaaagaggacaagaaaatacgtctggtttctggcttaaccgatct
aacgaactgatctggttagagctacaagcctggcatgcaggacggacaattaacgaccag
gacttctttttatatacagcccgtcaagccatcccagatattattaatgaaatccttact
ttcaaagtcgactatgggagcttcgcctttgttagagatagagctggttttaatggtact
tcagtagaagggcagtgcaaagccactcctggaacaaagattgtaggttactcaacacat
catgagcatctccaacgccagagggtctcatttgagcaggtaaaacggataatggagctg
ctagagtacatagaagcactttatccatcattgcaggctcttcagaaggactatgaaaaa
tatgctgcaaaagacttccaggacagggtgcaggcactctgtttgtggttaaacatcaca
aaagacttaaatcagaaattaaggattatgggcactgttttgggcatcaagaatttatca
gacattggctggccagtgtttgaaatcccttcccctcgaccatccaaaggtaatgagccg
gagtatgagggtgatgacacagaaggagaattaaaggagttggaaagtagtacggatgag
agtgaagaagaacaaatctctgatcctagggtaccggaaatcagacagcccatagataac
agcttcgacatccagtcgcgggactgcatatccaagaagcttgagaggctcgaatctgag
gatgattctcttggctggggagcaccagactggagcacagaagcaggctttagtagacat
tgtctgacttctatttatagaccatttgtagacaaagcactgaagcagatggggttaaga
aagttaattttaagacttcacaagctaatggatggttccttgcaaagggcacgtatagca
ttggtaaagaacgatcgtccagtggagttttctgaatttccagatcccatgtggggttca
gattatgtgcagttgtcaaggacaccaccttcatctgaggagaaatgcagtgctgtgtcg
tgggaggagctgaaggccatggatttaccttcattcgaacctgccttcctagttctctgc
cgagtccttctgaatgtcatacatgagtgtctgaagttaagattggagcagagacctgct
ggagaaccatctctcttgagtattaagcagctggtgagagagtgtaaggaggtcctgaag
ggcggcctgctgatgaagcagtactaccagttcatgctgcaggaggttctggaggacttg
gagaagcccgactgcaacattgacgcttttgaagaggatctacataaaatgcttatggtg
tattttgattacatgagaagctggatccaaatgctacagcaattacctcaagcatcgcat
agtttaaaaaatctgttagaagaagaatggaatttcaccaaagaaataactcattacata
cggggaggagaagcacaggccgggaagcttttctgtgacattgcaggaatgctgctgaaa
tctacaggaagttttttagaatttggcttacaggagagctgtgctgaattttggactagt
gcggatgacagcagtgcttccgacgaaatcaggaggtctgttatagagatcagtcgagcc
ctgaaggagctcttccatgaagccagagaaagggcttccaaagcacttggatttgctaaa
atgttgagaaaggacctggaaatagcagcagaattcaggctttcagccccagttagagac
ctcctggatgttctgaaatcaaaacagtatgtcaaggtgcaaattcctgggttagaaaac
ttgcaaatgtttgttccagacactcttgctgaggagaagagtattattttgcagttactc
aatgcagctgcaggaaaggactgttcaaaagattcagatgacgtactcatcgatgcctat
ctgcttctgaccaagcacggtgatcgagcccgtgattcagaggacagctggggcacctgg
gaggcacagcctgtcaaagtcgtgcctcaggtggagactgttgacaccctgagaagcatg
caggtggataatcttttactagttgtcatgcagtctgcgcatctcacaattcagagaaaa
gctttccagcagtccattgagggacttatgactctgtgccaggagcagacatccagtcag
ccggtcatcgccaaagctttgcagcagctgaagaatgatgcattggagctatgcaacagg
ataagcaatgccattgaccgcgtggaccacatgttcacatcagaatttgatgctgaggtt
gatgaatctgaatctgtcaccttgcaacagtactaccgagaagcaatgattcaggggtac
aattttggatttgagtatcataaagaagttgttcgtttgatgtctggggagtttagacag
aagataggagacaaatatataagctttgcccggaagtggatgaattatgtcctgactaaa
tgtgagagtggtagaggtacaagacccaggtgggcgactcaaggatttgattttctacaa
gcaattgaacctgcctttatttcagctttaccagaagatgacttcttgagtttacaagcc
ttgatgaatgaatgcattggccatgtcataggaaaaccacacagtcctgttacaggtttg
taccttgccattcatcggaacagcccccgtcctatgaaggtacctcgatgccatagtgac
cctcctaacccacacctcattatccccactccagagggattcagcactcggagcatgcct
tccgacgcgcggagccatggcagccctgctgctgctgctgctgctgctgctgctgctgtt
gctgccagtcggcccagcccctctggtggtgactctgtgctgcccaaatccatcagcagt
gcccatgataccaggggttccagcgttcctgaaaatgatcgattggcttccatagctgct
gaattgcagtttaggtccctgagtcgtcactcaagccccacggaggagcgagatgaacca
gcatatccaagaggagattcaagtgggtccacaagaagaagttgggaacttcggacacta
atcagccagagtaaagatactgcttctaaactaggacccatagaagctatccagaagtca
gtccgattgtttgaagaaaagaggtaccgagaaatgaggagaaagaatatcattggtcaa
gtttgtgatacgcctaagtcctatgataatgttatgcacgttggcttgaggaaggtgacc
ttcaaatggcaaagaggaaacaaaattggagaaggccagtatgggaaggtgtacacctgc
atcagcgtcgacaccggggagctgatggccatgaaagagattcgatttcaacctaatgac
cataagactatcaaggaaactgcagacgaattgaaaatattcgaaggcatcaaacacccc
aatctggttcggtattttggtgtggagctccatagagaagaaatgtacatcttcatggag
tactgcgatgaggggactttagaagaggtgtcaaggctgggacttcaggaacatgtgatt
aggctgtattcaaagcagatcaccattgcgatcaacgtcctccatgagcatggcatagtc
caccgtgacattaaaggtgccaatatcttccttacctcatctggattaatcaaactggga
gattttggatgttcagtaaagctcaaaaacaatgcccagaccatgcctggtgaagtgaac
agcaccctggggacagcagcatacatggcacctgaagtcatcactcgtgccaaaggagag
ggccatgggcgtgcggccgacatctggagtctggggtgtgttgtcatagagatggtgact
ggcaagaggccttggcatgagtatgagcacaactttcaaattatgtataaagtggggatg
ggacataagccaccaatccctgaaagattaagccctgaaggaaaggacttcctttctcac
tgccttgagagtgacccaaagatgagatggaccgccagccagctcctcgaccattcgttt
gtcaaggtttgcacagatgaagaatga

DBGET integrated database retrieval system